• Gene id: 6403

Gene Summary

• Gene Symbol: SELP   Gene   UCSC   Ensembl
• Aliases: CD62, CD62P, GMP140, GRMP, LECAM3, PADGEM, PSEL
• Gene name: selectin P
• Alternate names: P-selectin, CD62 antigen-like family member P, GMP-140, granule membrane protein 140, granule membrane protein 140kDa, granulocyte membrane protein, leukocyte-endothelial cell adhesion molecule 3, platelet activation dependent granule-external membrane protein, p,
• Gene location: 1q24.2 (169630124: 169588848)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interactio
• OMIM: 173610

Protein Summary

• Protein general information: P16109  
  • Name: P selectin (CD62 antigen like family member P) (Granule membrane protein 140) (GMP 140) (Leukocyte endothelial cell adhesion molecule 3) (LECAM3) (Platelet activation dependent granule external membrane protein) (PADGEM) (CD antigen CD62P)
  • Length: 830  
  • Mass: 90834
  • Tissue specificity: Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.
• Sequence:

  MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNE
  IDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHC
  LKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQ
  CSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVG
  PEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWS
  APLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQD
  LPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQ
  PLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHF
  SCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAG
  FTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQE
  NGHWSTTVPTCQAGPLTIQEALTYFGGAVASTIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAA
  FDPSP

• Structural information:
  • Protein Domains: (58..15-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040-)
    (159..19-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (198..25-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  IPR013032   IPR000742  IPR033991  IPR002396  IPR035976  IPR000436  
  • Prosite: PS00615 PS50041 PS00022 PS01186 PS50026 PS50923
  • CDD: cd00033 cd03592
  • PDB: 1FSB 1G1Q 1G1R 1G1S 1HES 1KJD
  • PDBsum: 1FSB 1G1Q 1G1R 1G1S 1HES 1KJD
  • DIP: 37667
  • STRING: ENSP00000263686
• Other Databases: GeneCards:  SELP  Malacards:  SELP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035584	calcium-mediated signaling using intracellular calcium source	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0031092	platelet alpha granule membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0031088	platelet dense granule membrane	TAS	cellular component
GO:0031092	platelet alpha granule membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0007159	leukocyte cell-cell adhesion	IEA	biological process
GO:0010572	positive regulation of platelet activation	IEA	biological process
GO:0033691	sialic acid binding	IEA	molecular function
GO:0050900	leukocyte migration	IEA	biological process
GO:1903238	positive regulation of leukocyte tethering or rolling	IEA	biological process
GO:0002687	positive regulation of leukocyte migration	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0050901	leukocyte tethering or rolling	IEA	biological process
GO:0033691	sialic acid binding	IDA	molecular function
GO:0008201	heparin binding	IDA	molecular function
GO:0042806	fucose binding	IDA	molecular function
GO:0070492	oligosaccharide binding	IDA	molecular function
GO:0043208	glycosphingolipid binding	TAS	molecular function
GO:0001530	lipopolysaccharide binding	IMP	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0010572	positive regulation of platelet activation	ISS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0032496	response to lipopolysaccharide	IC	biological process
GO:0050829	defense response to Gram-negative bacterium	IC	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0070492	oligosaccharide binding	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0070492	oligosaccharide binding	IDA	molecular function
GO:0033623	regulation of integrin activation	IMP	biological process
GO:1903238	positive regulation of leukocyte tethering or rolling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050901	leukocyte tethering or rolling	IMP	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa05150	Staphylococcus aureus infection
hsa05144	Malaria

Diseases

Associated diseases	References
Alzheimer's disease	PMID:21484243
Sjogren's syndrome	PMID:19832990
Kawasaki disease	PMID:20079717
Chronic obstructive pulmonary disease	PMID:20646456
Atopic dermatitis	PMID:12929084
Myocardial infarction	PMID:17391113
Myocardial infarction	PMID:12165563
juvenile rheumatoid arthritis	PMID:21124648
intermediate coronary syndrome	PMID:21162967
type 2 diabetes mellitus	PMID:17598012
obesity	PMID:19228864
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)