• Gene id: 6402

Gene Summary

• Gene Symbol: SELL   Gene   UCSC   Ensembl
• Aliases: CD62L, LAM1, LECAM1, LEU8, LNHR, LSEL, LYAM1, PLNHR, TQ1
• Gene name: selectin L
• Alternate names: L-selectin, CD62 antigen-like family member L, gp90-MEL, leukocyte surface antigen Leu-8, leukocyte-endothelial cell adhesion molecule 1, lymph node homing receptor, lymphocyte adhesion molecule 1, pln homing receptor,
• Gene location: 1q24.2 (169711619: 169690666)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeat
• OMIM: 118510

Protein Summary

• Protein general information: P14151  
  • Name: L selectin (CD62 antigen like family member L) (Leukocyte adhesion molecule 1) (LAM 1) (Leukocyte surface antigen Leu 8) (Leukocyte endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (TQ1) (gp90 MEL) (CD antigen CD62L)
  • Length: 372  
  • Mass: 42187
  • Tissue specificity: Expressed in B-cell lines and T-lymphocytes. {ECO
• Sequence:

  MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEY
  LEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKL
  KAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAF
  SCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK
  TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY

• Structural information:
  • Protein Domains: (55..15-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040-)
    (156..19-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (195..25-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  IPR013032   IPR000742  IPR016348  IPR033991  IPR002396  IPR035976  IPR000436  
  • Prosite: PS00615 PS50041 PS00022 PS01186 PS50026 PS50923
  • CDD: cd00033 cd03592
  • PDB: 1KJB 2LGF 3CFW 5VC1
  • PDBsum: 1KJB 2LGF 3CFW 5VC1
  • STRING: ENSP00000236147
• Other Databases: GeneCards:  SELL  Malacards:  SELL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070492	oligosaccharide binding	IMP	molecular function
GO:0050901	leukocyte tethering or rolling	IMP	biological process
GO:0016339	calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	biological process
GO:0050900	leukocyte migration	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0030246	carbohydrate binding	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0050839	cell adhesion molecule binding	IEA	molecular function
GO:0033198	response to ATP	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043208	glycosphingolipid binding	TAS	molecular function
GO:0002020	protease binding	IPI	molecular function
GO:0008201	heparin binding	TAS	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Alzheimer's disease	PMID:21484243
Crohn's disease	PMID:19212205
Systemic lupus erythematosus	PMID:20512127
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray