• Gene id: 64005

Gene Summary

• Gene Symbol: MYO1G   Gene   UCSC   Ensembl
• Aliases: HA2, HLA-HA2, MHAG
• Gene name: myosin IG
• Alternate names: unconventional myosin-Ig, minor histocompatibility antigen HA-2, myosin-Ig,
• Gene location: 7p13 (44979104: 44962661)     Exons: 22     NC_000007.14
• Gene summary(Entrez): MYO1G is a plasma membrane-associated class I myosin (see MIM 601478) that is abundant in T and B lymphocytes and mast cells (Pierce et al., 2001 [PubMed 11544309]; Patino-Lopez et al., 2010 [PubMed 20071333]).[supplied by OMIM, Jun 2010]
• OMIM: 605516

Protein Summary

• Protein general information: B0I1T2  
  • Name: Unconventional myosin Ig [Cleaved into: Minor histocompatibility antigen HA 2 (mHag HA 2)]
  • Length: 1018  
  • Mass: 116442
  • Tissue specificity: Specifically expressed in hematopoietic cells. {ECO
• Sequence:

  MEDEEGPEYGKPDFVLLDQVTMEDFMRNLQLRFEKGRIYTYIGEVLVSVNPYQELPLYGPEAIARYQGRELYERP
  PHLYAVANAAYKAMKHRSRDTCIVISGESGAGKTEASKHIMQYIAAVTNPSQRAEVERVKDVLLKSTCVLEAFGN
  ARTNRNHNSSRFGKYMDINFDFKGDPIGGHIHSYLLEKSRVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNP
  AVYNFTHQGAGLNMTVHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGL
  AVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVYQRLFEWVVNRINSVM
  EPRGRDPRRDGKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQQLFIQLILKQEQEEYEREGITWQSVEYFNN
  ATIVDLVERPHRGILAVLDEACSSAGTITDRIFLQTLDMHHRHHLHYTSRQLCPTDKTMEFGRDFRIKHYAGDVT
  YSVEGFIDKNRDFLFQDFKRLLYNSTDPTLRAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVR
  CIKPNEDKVAGKLDENHCRHQVAYLGLLENVRVRRAGFASRQPYSRFLLRYKMTCEYTWPNHLLGSDKAAVSALL
  EQHGLQGDVAFGHSKLFIRSPRTLVTLEQSRARLIPIIVLLLQKAWRGTLARWRCRRLRAIYTIMRWFRRHKVRA
  HLAELQRRFQAARQPPLYGRDLVWPLPPAVLQPFQDTCHALFCRWRARQLVKNIPPSDMPQIKAKVAAMGALQGL
  RQDWGCRRAWARDYLSSATDNPTASSLFAQRLKTLQDKDGFGAVLFSSHVRKVNRFHKIRNRALLLTDQHLYKLD
  PDRQYRVMRAVPLEAVTGLSVTSGGDQLVVLHARGQDDLVVCLHRSRPPLDNRVGELVGVLAAHCQGEGRTLEVR
  VSDCIPLSHRGVRRLISVEPRPEQPEPDFRCARGSFTLLWPSR

• Structural information:
  • Protein Domains: (9..70-)
    (/note="Myosin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00782-)
    (710..73-)
    (/note="IQ-)
    (824..101-)
    (/note="TH1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01093"-)
  • Interpro: IPR036961  IPR001609  IPR010926  IPR036072  IPR027417  
  • Prosite: PS51456 PS51757
  • CDD: cd01378
  • STRING: ENSP00000258787
• Other Databases: GeneCards:  MYO1G  Malacards:  MYO1G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000146	microfilament motor activity	IBA	molecular function
GO:0005902	microvillus	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0015629	actin cytoskeleton	IBA	cellular component
GO:0030050	vesicle transport along actin filament	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0030898	actin-dependent ATPase activity	IBA	molecular function
GO:0031982	vesicle	IBA	cellular component
GO:0001891	phagocytic cup	ISS	cellular component
GO:0072678	T cell migration	ISS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	ISS	biological process
GO:0002456	T cell mediated immunity	ISS	biological process
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	ISS	molecular function
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	ISS	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	ISS	molecular function
GO:0003774	motor activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016459	myosin complex	IEA	cellular component
GO:0005516	calmodulin binding	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016459	myosin complex	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0071976	cell gliding	IEA	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	IEA	biological process
GO:0031589	cell-substrate adhesion	IEA	biological process
GO:0031256	leading edge membrane	IEA	cellular component
GO:0030175	filopodium	IEA	cellular component
GO:0006909	phagocytosis	IEA	biological process
GO:0005902	microvillus	IEA	cellular component
GO:0002456	T cell mediated immunity	IEA	biological process
GO:0001891	phagocytic cup	IEA	cellular component
GO:0120117	T cell meandering migration	IEA	biological process
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IEA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0006887	exocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IEA	molecular function
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IEA	molecular function
GO:0001891	phagocytic cup	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq