• Gene id: 6398

Gene Summary

• Gene Symbol: SECTM1   Gene   UCSC   Ensembl
• Aliases: K12, SECTM
• Gene name: secreted and transmembrane 1
• Alternate names: secreted and transmembrane protein 1, type 1a transmembrane protein,
• Gene location: 17q25.3 (82333950: 82321023)     Exons: 7     NC_000017.11
• Gene summary(Entrez): This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. [provided by RefSeq
• OMIM: 610745

Protein Summary

• Protein general information: Q8WVN6  
  • Name: Secreted and transmembrane protein 1 (Protein K 12)
  • Length: 248  
  • Mass: 27039
  • Tissue specificity: Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes.
• Sequence:

  MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQES
  AIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVP
  AVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVF
  KPSPLGALELLSPQPLFPYAADP

• Structural information:
  • Interpro: IPR013783  IPR033231  
  • STRING: ENSP00000269389
• Other Databases: GeneCards:  SECTM1  Malacards:  SECTM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IDA	cellular component
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005125	cytokine activity	TAS	molecular function
GO:0006955	immune response	TAS	biological process
GO:0007498	mesoderm development	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0005794	Golgi apparatus	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R