• Gene id: 63979

Gene Summary

• Gene Symbol: FIGNL1   Gene   UCSC   Ensembl
• Gene name: fidgetin like 1
• Alternate names: fidgetin-like protein 1,
• Gene location: 7p12.2 (50450405: 50437319)     Exons: 5     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the AAA ATPase family of proteins. The encoded protein is recruited to sites of DNA damage where it plays a role in DNA double-strand break repair via homologous recombination. This protein has also been shown to localize to
• OMIM: 600584

Protein Summary

• Protein general information: Q6PIW4  
  • Name: Fidgetin like protein 1 (EC 3.6.4. )
  • Length: 674  
  • Mass: 74077
• Sequence:

  MQTSSSRSVHLSEWQKNYFAITSGICTGPKADAYRAQILRIQYAWANSEISQVCATKLFKKYAEKYSAIIDSDNV
  ESGLNNYAENILTLAGSQQTDSDKWQSGLSINNVFKMSSVQKMMQAGKKFKDSLLEPALASVVIHKEATVFDLPK
  FSVCGSSQESDSLPNSAHDRDRTQDFPESNRLKLLQNAQPPMVTNTARTCPTFSAPVGESATAKFHVTPLFGNVK
  KENHSSAKENIGLNVFLSNQSCFPAACENPQRKSFYGSGTIDALSNPILNKACSKTEDNGPKEDSSLPTFKTAKE
  QLWVDQQKKYHQPQRASGSSYGGVKKSLGASRSRGILGKFVPPIPKQDGGEQNGGMQCKPYGAGPTEPAHPVDER
  LKNLEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLI
  GKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGEHESSRRIKTEFL
  VQLDGATTSSEDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVINLMSKEQCCLSEEEIEQIVQQS
  DAFSGADMTQLCREASLGPIRSLQTADIATITPDQVRPIAYIDFENAFRTVRPSVSPKDLELYENWNKTFGCGK

• Structural information:
  • Interpro: IPR003593  IPR003959  IPR003960  IPR027417  IPR015415  
  • Prosite: PS00674
  • PDB: 3D8B
  • PDBsum: 3D8B
  • STRING: ENSP00000410811
• Other Databases: GeneCards:  FIGNL1  Malacards:  FIGNL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0016887	ATPase activity	IBA	molecular function
GO:0008568	microtubule-severing ATPase activity	IBA	molecular function
GO:0010569	regulation of double-strand break repair via homologous recombination	IBA	biological process
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0010569	regulation of double-strand break repair via homologous recombination	IDA	biological process
GO:0071479	cellular response to ionizing radiation	IDA	biological process
GO:0000228	nuclear chromosome	IDA	cellular component
GO:0007140	male meiotic nuclear division	ISS	biological process
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033687	osteoblast proliferation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:2001243	negative regulation of intrinsic apoptotic signaling pathway	IEA	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0007140	male meiotic nuclear division	IEA	biological process
GO:0001649	osteoblast differentiation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0051013	microtubule severing	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0046034	ATP metabolic process	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process
GO:0016787	hydrolase activity	ISS	molecular function
GO:0001649	osteoblast differentiation	ISS	biological process
GO:0000287	magnesium ion binding	ISS	molecular function
GO:0033687	osteoblast proliferation	ISS	biological process
GO:0051726	regulation of cell cycle	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881