• Gene id: 63973

Gene Summary

• Gene Symbol: NEUROG2   Gene   UCSC   Ensembl
• Aliases: Atoh4, Math4A, NGN2, bHLHa8, ngn-2
• Gene name: neurogenin 2
• Alternate names: neurogenin-2, class A basic helix-loop-helix protein 8, protein atonal homolog 4,
• Gene location: 4q25 (112516179: 112513515)     Exons: 2     NC_000004.12
• Gene summary(Entrez): This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The prote
• OMIM: 606624

Protein Summary

• Protein general information: Q9H2A3  
  • Name: Neurogenin 2 (NGN 2) (Class A basic helix loop helix protein 8) (bHLHa8) (Protein atonal homolog 4)
  • Length: 272  
  • Mass: 28621
• Sequence:

  MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCR
  PARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK
  IETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSS
  VSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI

• Structural information:
  • Protein Domains: (112..16-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  IPR032655  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000317333
• Other Databases: GeneCards:  NEUROG2  Malacards:  NEUROG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0070888	E-box binding	ISS	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030182	neuron differentiation	IEA	biological process
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)