Search Result
Gene id | 63973 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Symbol | NEUROG2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Aliases | Atoh4, Math4A, NGN2, bHLHa8, ngn-2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene name | neurogenin 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Alternate names | neurogenin-2, class A basic helix-loop-helix protein 8, protein atonal homolog 4, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene location |
4q25 (112516179: 112513515) Exons: 2 NC_000004.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene summary(Entrez) |
This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The prote |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
OMIM | 606624 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein general information | Q9H2A3 Name: Neurogenin 2 (NGN 2) (Class A basic helix loop helix protein 8) (bHLHa8) (Protein atonal homolog 4) Length: 272 Mass: 28621 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequence |
MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCR PARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTK IETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSS VSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Databases | GeneCards: NEUROG2 Malacards: NEUROG2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontologyExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed referencesExpand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|