• Gene id: 63941

Gene Summary

• Gene Symbol: NECAB3   Gene   UCSC   Ensembl
• Aliases: APBA2BP, EFCBP3, NIP1, STIP3, SYTIP2, XB51, dJ63M2.4, dJ63M2.5
• Gene name: N-terminal EF-hand calcium binding protein 3
• Alternate names: N-terminal EF-hand calcium-binding protein 3, EF-hand calcium binding protein 3, Nek2-interacting protein 1, X11L-binding protein 51, amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein, amyloid beta A4 protein-binding family A memb,
• Gene location: 20q11.22 (33674427: 33657086)     Exons: 16     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of
• OMIM: 154545

Protein Summary

• Protein general information: Q96P71  
  • Name: N terminal EF hand calcium binding protein 3 (Amyloid beta A4 protein binding family A member 2 binding protein) (Nek2 interacting protein 1) (Neuronal calcium binding protein 3) (X11L binding protein 51)
  • Length: 396  
  • Mass: 44350
  • Tissue specificity: Strongly expressed in heart and skeletal muscle, moderately in brain and pancreas. {ECO
• Sequence:

  MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGEL
  QELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETV
  SQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWR
  LQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQR
  QVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHL
  RAPDTLTTVFFPASWWIMNNN

• Structural information:
  • Protein Domains: (36..7-)
    (/note="EF-hand-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (296..38-)
    (/note="ABM"-)
  • Interpro: IPR007138  IPR011008  IPR011992  IPR018247  IPR002048   IPR039862  
  • Prosite: PS51725 PS00018 PS50222
  • STRING: ENSP00000246190
• Other Databases: GeneCards:  NECAB3  Malacards:  NECAB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0042984	regulation of amyloid precursor protein biosynthetic process	IBA	biological process
GO:0000137	Golgi cis cisterna	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0000137	Golgi cis cisterna	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000137	Golgi cis cisterna	IDA	cellular component
GO:0042984	regulation of amyloid precursor protein biosynthetic process	IDA	biological process
GO:0019538	protein metabolic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0009306	protein secretion	NAS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray