• Gene id: 63928

Gene Summary

• Gene Symbol: CHP2   Gene   UCSC   Ensembl
• Gene name: calcineurin like EF-hand protein 2
• Alternate names: calcineurin B homologous protein 2, hepatocellular carcinoma antigen gene 520, hepatocellular carcinoma-associated antigen 520,
• Gene location: 16p12.2 (75768732: 75801535)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene product is a small calcium-binding protein that regulates cell pH by controlling plasma membrane-type Na+/H+ exchange activity. This protein shares sequence similarity with calcineurin B and can bind to and stimulate the protein phosphatase acti

Protein Summary

• Protein general information: O43745  
  • Name: Calcineurin B homologous protein 2 (Hepatocellular carcinoma associated antigen 520)
  • Length: 196  
  • Mass: 22452
  • Tissue specificity: Expressed in malignantly transformed cells but not detected in normal tissues. {ECO
• Sequence:

  MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESFFPDGS
  QRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTE
  EQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK

• Structural information:
  • Protein Domains: (26..6-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (71..10-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (111..14-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00-)
  • Interpro: IPR011992  IPR018247  IPR002048  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • PDB: 2BEC
  • PDBsum: 2BEC
  • STRING: ENSP00000300113
• Other Databases: GeneCards:  CHP2  Malacards:  CHP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071277	cellular response to calcium ion	IDA	biological process
GO:0042307	positive regulation of protein import into nucleus	IDA	biological process
GO:0010922	positive regulation of phosphatase activity	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005509	calcium ion binding	IDA	molecular function
GO:0070886	positive regulation of calcineurin-NFAT signaling cascade	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)