• Gene id: 63908

Gene Summary

• Gene Symbol: NAPB   Gene   UCSC   Ensembl
• Aliases: SNAP-BETA, SNAPB
• Gene name: NSF attachment protein beta
• Alternate names: beta-soluble NSF attachment protein, N-ethylmaleimide-sensitive factor attachment protein, beta,
• Gene location: 20p11.21 (23421518: 23374518)     Exons: 13     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the soluble N-ethyl-maleimide-sensitive fusion attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. This gen

Protein Summary

• Protein general information: Q9H115  
  • Name: Beta soluble NSF attachment protein (SNAP beta) (N ethylmaleimide sensitive factor attachment protein beta)
  • Length: 298  
  • Mass: 33557
• Sequence:

  MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSAAGNAFCQAAKLHMQL
  QSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIAAKHHITIAEIYETELVDIEKAIAHYEQSAD
  YYKGEESNSSANKCLLKVAAYAAQLEQYQKAIEIYEQVGANTMDNPLLKYSAKDYFFKAALCHFIVDELNAKLAL
  EKYEEMFPAFTDSRECKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTMLLRIKKSIQGDGEGDGDLK

• Structural information:
  • Interpro: IPR000744  IPR011990  
  • CDD: cd15832
  • STRING: ENSP00000482826
• Other Databases: GeneCards:  NAPB  Malacards:  NAPB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005774	vacuolar membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0019905	syntaxin binding	IBA	molecular function
GO:0035494	SNARE complex disassembly	IBA	biological process
GO:0070044	synaptobrevin 2-SNAP-25-syntaxin-1a complex	IBA	cellular component
GO:0005483	soluble NSF attachment protein activity	IBA	molecular function
GO:0010807	regulation of synaptic vesicle priming	IBA	biological process
GO:0031201	SNARE complex	IBA	cellular component
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Alzheimer's disease	PMID:11244216
Down syndrome	PMID:11244216
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq