• Gene id: 6390

Gene Summary

• Gene Symbol: SDHB   Gene   UCSC   Ensembl
• Aliases: CWS2, IP, PGL4, SDH, SDH1, SDH2, SDHIP
• Gene name: succinate dehydrogenase complex iron sulfur subunit B
• Alternate names: succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial, iron-sulfur subunit of complex II, succinate dehydrogenase complex, subunit B, iron sulfur (Ip),
• Gene location: 1p36.13 (17054169: 17018721)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-
• OMIM: 185470

Protein Summary

• Protein general information: P21912  
  • Name: Succinate dehydrogenase [ubiquinone] iron sulfur subunit, mitochondrial (EC 1.3.5.1) (Iron sulfur subunit of complex II) (Ip)
  • Length: 280  
  • Mass: 31,630
• Sequence:

  MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDA
  LIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQY
  KSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDD
  FTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

• Structural information:
  • Protein Domains: 2Fe-2S (40-133)
    4Fe-4S (176-206)
  • Interpro: IPR036010  IPR001041  IPR006058  IPR017896  IPR017900   IPR012675  IPR009051  IPR004489  IPR025192  
  • Prosite: PS00197 PS51085 PS00198 PS51379
  • CDD: cd00207
  • DIP: 39666
  • STRING: ENSP00000364649
• Other Databases: GeneCards:  SDHB  Malacards:  SDHB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	ISS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006105	succinate metabolic process	IEA	biological process
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IEA	molecular function
GO:0009055	electron carrier activity	IEA	molecular function
GO:0009060	aerobic respiration	TAS	biological process
GO:0022904	respiratory electron transport chain	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0048039	ubiquinone binding	ISS	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	ISS	molecular function
GO:0051538	3 iron, 4 sulfur cluster binding	ISS	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	ISS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	IEA	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	ISS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006105	succinate metabolic process	IEA	biological process
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IEA	molecular function
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IEA	molecular function
GO:0009055	electron carrier activity	IEA	molecular function
GO:0009060	aerobic respiration	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0022904	respiratory electron transport chain	IEA	biological process
GO:0045273	respiratory chain complex II	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0048039	ubiquinone binding	ISS	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	ISS	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0051538	3 iron, 4 sulfur cluster binding	ISS	molecular function
GO:0051538	3 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	ISS	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	ISS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0009060	aerobic respiration	TAS	biological process
GO:0048039	ubiquinone binding	ISS	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	ISS	molecular function
GO:0051538	3 iron, 4 sulfur cluster binding	ISS	molecular function
GO:0051539	4 iron, 4 sulfur cluster binding	ISS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa04714	Thermogenesis
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa05016	Huntington disease
hsa04932	Non-alcoholic fatty liver disease

Diseases

Associated diseases	References
Adrenal gland neoplasms	GAD: 19029228
Cancer	GAD: 17639058
Cancer (head and neck)	GAD: 18551016
Cancer (paragangliomas)	GAD: 16912137
Cancer (prostate)	GAD: 19064571
Cancer (renal cell)	GAD: 14685938
Cancer (thyroid)	GAD: 16322339
Paraganglioma	OMIM: 185470
Paragangliomas 4	OMIM: 185470
Pheochromocytomas	OMIM: 185470
Cowden syndrome	OMIM: 185470
Gastrointestinal stromal tumor	OMIM: 185470
Spermatogenesis defects	GAD: 17298551
Asthenozoospermia	MIK: 22985091
Malignant paraganglioma	KEGG: H01510
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 22985091
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
22985091	Asthenozoospermia				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray