• Gene id: 6389

Gene Summary

• Gene Symbol: SDHA   Gene   UCSC   Ensembl
• Aliases: CMD1GG, FP, PGL5, SDH1, SDH2, SDHF
• Gene name: succinate dehydrogenase complex flavoprotein subunit A
• Alternate names: succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial, flavoprotein subunit of complex II, succinate dehydrogenase complex, subunit A, flavoprotein (Fp),
• Gene location: 5p15.33 (218222: 264815)     Exons: 16     NC_000005.10
• Gene summary(Entrez): This gene encodes a major catalytic subunit of succinate-ubiquinone oxidoreductase, a complex of the mitochondrial respiratory chain. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. Mutations
• OMIM: 600857

Protein Summary

• Protein general information: P31040  
  • Name: Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (EC 1.3.5.1) (Flavoprotein subunit of complex II) (Fp)
  • Length: 664  
  • Mass: 72,692
• Sequence:

  MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDHEFDAVVVGAGGAGLR
  AAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAV
  VELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLL
  MENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
  YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHLPPEQ
  LATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQIVPGLYACGEAACASVHGAN
  RLGANSLLDLVVFGRACALSIEESCRPGDKVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAV
  FRVGSVLQEGCGKISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
  IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPAIRSY

• Structural information:
  • Interpro: IPR003953  IPR036188  IPR003952  IPR037099  IPR015939   IPR027477  IPR011281  IPR014006  
  • Prosite: PS00504
  • DIP: 45851
  • STRING: ENSP00000264932
• Other Databases: GeneCards:  SDHA  Malacards:  SDHA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	ISS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	TAS	cellular component
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006105	succinate metabolic process	IDA	biological process
GO:0007399	nervous system development	IMP	biological process
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IMP	molecular function
GO:0022904	respiratory electron transport chain	IDA	biological process
GO:0043209	myelin sheath	IEA	cellular component
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0000104	succinate dehydrogenase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	ISS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	TAS	cellular component
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	IEA	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006105	succinate metabolic process	IEA	biological process
GO:0006105	succinate metabolic process	IDA	biological process
GO:0007399	nervous system development	IMP	biological process
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IEA	molecular function
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IEA	molecular function
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IMP	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	IEA	molecular function
GO:0022900	electron transport chain	IEA	biological process
GO:0022904	respiratory electron transport chain	IEA	biological process
GO:0022904	respiratory electron transport chain	IDA	biological process
GO:0043209	myelin sheath	IEA	cellular component
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0000104	succinate dehydrogenase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	ISS	cellular component
GO:0005749	mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone)	TAS	cellular component
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006099	tricarboxylic acid cycle	TAS	biological process
GO:0006105	succinate metabolic process	IDA	biological process
GO:0007399	nervous system development	IMP	biological process
GO:0008177	succinate dehydrogenase (ubiquinone) activity	IMP	molecular function
GO:0022904	respiratory electron transport chain	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0000104	succinate dehydrogenase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa04714	Thermogenesis
hsa05010	Alzheimer disease
hsa05012	Parkinson disease
hsa05016	Huntington disease
hsa04932	Non-alcoholic fatty liver disease

Diseases

Associated diseases	References
Cancer (prostate)	GAD: 19064571
Paragangliomas 5	OMIM: 600857
Cardiomyopathy	OMIM: 600857
Mitochondrial diseases	KEGG: H00473
Leigh syndrome	OMIM: 600857
Spermatogenesis defects	GAD: 17298551
Endometriosis	INFBASE: 26240828
Spermatogenesis defects	MIK: 17298551
Diseases of the tricarboxylic acid cycle	KEGG: H01022
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 17298551
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17298551	Impaired spermatogenesis	SDHA (c.456+32G>A)			Male infertility	SDHA
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq