• Gene id: 6388

Gene Summary

• Gene Symbol: SDF2   Gene   UCSC   Ensembl
• Gene name: stromal cell derived factor 2
• Alternate names: stromal cell-derived factor 2, SDF-2,
• Gene location: 17q11.2 (28662188: 28648345)     Exons: 5     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alterna
• OMIM: 602934

Protein Summary

• Protein general information: Q99470  
  • Name: Stromal cell derived factor 2 (SDF 2)
  • Length: 211  
  • Mass: 23026
• Sequence:

  MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGK
  SATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRF
  KHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAEL

• Structural information:
  • Protein Domains: (21..7-)
    (/note="MIR-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00131-)
    (83..13-)
    (/note="MIR-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00131-)
    (139..19-)
    (/note="MIR-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00131"-)
  • Interpro: IPR036300  IPR016093  
  • Prosite: PS50919
  • STRING: ENSP00000247020
• Other Databases: GeneCards:  SDF2  Malacards:  SDF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0004169	dolichyl-phosphate-mannose-protein mannosyltransferase activity	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0006486	protein glycosylation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0035269	protein O-linked mannosylation	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq