• Gene id: 6385

Gene Summary

• Gene Symbol: SDC4   Gene   UCSC   Ensembl
• Aliases: SYND4
• Gene name: syndecan 4
• Alternate names: syndecan-4, amphiglycan, ryudocan amphiglycan, ryudocan core protein, syndecan 4 (amphiglycan, ryudocan), syndecan proteoglycan 4,
• Gene location: 20q13.12 (4379711: 4368226)     Exons: 3     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene i
• OMIM: 600017

Protein Summary

• Protein general information: P31431  
  • Name: Syndecan 4 (SYND4) (Amphiglycan) (Ryudocan core protein)
  • Length: 198  
  • Mass: 21642
  • Tissue specificity: Expressed in epithelial and fibroblastic cells. {ECO
• Sequence:

  MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIG
  PEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEVLAAL
  IVGGIVGILFAVFLILLLMYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

• Structural information:
  • Interpro: IPR003585  IPR001050  IPR027789  IPR030479  
  • Prosite: PS00964
  • PDB: 1EJP 1EJQ 1OBY 1YBO
  • PDBsum: 1EJP 1EJQ 1OBY 1YBO
  • DIP: 29945
  • STRING: ENSP00000361818
• Other Databases: GeneCards:  SDC4  Malacards:  SDC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0042130	negative regulation of T cell proliferation	IMP	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0001657	ureteric bud development	IEA	biological process
GO:0060122	inner ear receptor cell stereocilium organization	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IEA	biological process
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0043034	costamere	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0001968	fibronectin binding	IEA	molecular function
GO:0010762	regulation of fibroblast migration	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0001843	neural tube closure	IEA	biological process
GO:0070053	thrombospondin receptor activity	IMP	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903543	positive regulation of exosomal secretion	IMP	biological process
GO:1903553	positive regulation of extracellular exosome assembly	IMP	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05205	Proteoglycans in cancer
hsa04514	Cell adhesion molecules
hsa05418	Fluid shear stress and atherosclerosis
hsa04512	ECM-receptor interaction

Diseases

Associated diseases	References
Myocardial infarction	PMID:11372670
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881