• Gene id: 63827

Gene Summary

• Gene Symbol: BCAN   Gene   UCSC   Ensembl
• Aliases: BEHAB, CSPG7
• Gene name: brevican
• Alternate names: brevican core protein, brain-enriched hyaluronan-binding protein, chondroitin sulfate proteoglycan 7, chondroitin sulfate proteoglycan BEHAB,
• Gene location: 1q23.1 (156642116: 156659527)     Exons: 15     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the lectican family of chondroitin sulfate proteoglycans that is specifically expressed in the central nervous system. This protein is developmentally regulated and may function in the formation of the brain extracellular mat
• OMIM: 600347

Protein Summary

• Protein general information: Q96GW7  
  • Name: Brevican core protein (Brain enriched hyaluronan binding protein) (BEHAB) (Chondroitin sulfate proteoglycan 7)
  • Length: 911  
  • Mass: 99118
  • Tissue specificity: Expressed in the retina, specifically in the inner nuclear layer, inner plexiform layer and ganglion cell layer (at protein level). {ECO
• Sequence:

  MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVHYLRPPPSRRAVLGSP
  RVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAV
  EVKVKGVVFLYREGSARYAFSFSGAQEACARIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACY
  GDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDH
  CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPSAIPEASNPASNPASD
  GLEAIVTVTETLEELQLPQEATESESRGAIYSIPIMEDGGGGSSTPEDPAEAPRTLLEFETQSMVPPTGFSEEEG
  KALEEEEKYEDEEEKEEEEEEEEVEDEALWAWPSELSSPGPEASLPTEPAAQEESLSQAPARAVLQPGASPLPDG
  ESEASRPPRVHGPPTETLPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRA
  PEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGTCLEEEEGVRCLCLPG
  YGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYGAHLASISTPEEQDFINNRYREYQWIGLNDR
  TIEGDFLWSDGVPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQ
  VFGRPRLRYEVDTVLRYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKAL
  LIPPSSPMPGP

• Structural information:
  • Protein Domains: (36..15-)
    (/note="Ig-like-V-type)
    (157..25-)
    (/note="Link-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00323-)
    (257..35-)
    (/note="Link-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00323-)
    (646..68-)
    (/note="EGF-like-)
    (/eviden-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR016187  IPR013032   IPR000742  IPR007110  IPR036179  IPR013783  IPR003006  IPR003599  IPR013106  IPR000538  IPR035976  IPR000436  
  • Prosite: PS00615 PS50041 PS00022 PS01186 PS50026 PS50835 PS00290 PS01241 PS50963 PS50923
  • CDD: cd00033
  • STRING: ENSP00000331210
• Other Databases: GeneCards:  BCAN  Malacards:  BCAN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001501	skeletal system development	IBA	biological process
GO:0007417	central nervous system development	IBA	biological process
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0031012	extracellular matrix	IEA	cellular component
GO:0021766	hippocampus development	IEA	biological process
GO:0060074	synapse maturation	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Retinitis pigmentosa	PMID:29150673
Malignant glioma	PMID:16061654
Malignant glioma	PMID:23253190
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)