• Gene id: 63826

Gene Summary

• Gene Symbol: SRR   Gene   UCSC   Ensembl
• Aliases: ILV1, ISO1
• Gene name: serine racemase
• Alternate names: serine racemase, D-serine ammonia-lyase, D-serine dehydratase, L-serine ammonia-lyase, L-serine dehydratase,
• Gene location: 17p13.3 (2303370: 2325266)     Exons: 11     NC_000017.11

Protein Summary

• Protein general information: Q9GZT4  
  • Name: Serine racemase (EC 5.1.1.18) (D serine ammonia lyase) (D serine dehydratase) (EC 4.3.1.18) (L serine ammonia lyase) (L serine dehydratase) (EC 4.3.1.17)
  • Length: 340  
  • Mass: 36566
  • Tissue specificity: Brain
• Sequence:

  MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERK
  PKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIM
  VHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGK
  LMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT
  VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

• Structural information:
  • Interpro: IPR001926  IPR000634  IPR036052  
  • Prosite: PS00165
  • PDB: 3L6B 3L6R 5X2L
  • PDBsum: 3L6B 3L6R 5X2L
  • STRING: ENSP00000339435
• Other Databases: GeneCards:  SRR  Malacards:  SRR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	IBA	molecular function
GO:0018114	threonine racemase activity	IBA	molecular function
GO:0030170	pyridoxal phosphate binding	IBA	molecular function
GO:0030378	serine racemase activity	IBA	molecular function
GO:0003941	L-serine ammonia-lyase activity	IBA	molecular function
GO:0005524	ATP binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006563	L-serine metabolic process	IBA	biological process
GO:0042866	pyruvate biosynthetic process	IBA	biological process
GO:0070179	D-serine biosynthetic process	IBA	biological process
GO:0070178	D-serine metabolic process	IDA	biological process
GO:0030378	serine racemase activity	IDA	molecular function
GO:0030170	pyridoxal phosphate binding	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0006563	L-serine metabolic process	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0006520	cellular amino acid metabolic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016853	isomerase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0030378	serine racemase activity	IEA	molecular function
GO:0003941	L-serine ammonia-lyase activity	IEA	molecular function
GO:0008721	D-serine ammonia-lyase activity	IEA	molecular function
GO:0006564	L-serine biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070178	D-serine metabolic process	IEA	biological process
GO:0045177	apical part of cell	IEA	cellular component
GO:0043278	response to morphine	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0030378	serine racemase activity	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0030378	serine racemase activity	IEA	molecular function
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0018114	threonine racemase activity	IEA	molecular function
GO:0016594	glycine binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0006563	L-serine metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0070179	D-serine biosynthetic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0009069	serine family amino acid metabolic process	IEA	biological process
GO:0006563	L-serine metabolic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0030378	serine racemase activity	IDA	molecular function
GO:0070179	D-serine biosynthetic process	IDA	biological process
GO:0070179	D-serine biosynthetic process	IDA	biological process
GO:0043025	neuronal cell body	IDA	cellular component
GO:0006563	L-serine metabolic process	IDA	biological process
GO:0030378	serine racemase activity	IDA	molecular function
GO:0042866	pyruvate biosynthetic process	IDA	biological process
GO:0006563	L-serine metabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0003941	L-serine ammonia-lyase activity	IDA	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0030165	PDZ domain binding	IPI	molecular function
GO:0005524	ATP binding	ISS	molecular function
GO:0018114	threonine racemase activity	ISS	molecular function
GO:0016594	glycine binding	ISS	molecular function
GO:0032496	response to lipopolysaccharide	IEP	biological process
GO:0009069	serine family amino acid metabolic process	ISS	biological process
GO:0030170	pyridoxal phosphate binding	ISS	molecular function
GO:0005509	calcium ion binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00260	Glycine, serine and threonine metabolism

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq