• Gene id: 6382

Gene Summary

• Gene Symbol: SDC1   Gene   UCSC   Ensembl
• Aliases: CD138, SDC, SYND1, syndecan
• Gene name: syndecan 1
• Alternate names: syndecan-1, CD138 antigen, heparan sulfate proteoglycan fibroblast growth factor receptor, syndecan proteoglycan 1,
• Gene location: 2p24.1 (20225432: 20200796)     Exons: 9     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are req

Protein Summary

• Protein general information: P18827  
  • Name: Syndecan 1 (SYND1) (CD antigen CD138)
  • Length: 310  
  • Mass: 32462
• Sequence:

  MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIP
  TSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHLASTTTATTAQEPAT
  SHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQDFTFETSGENTAVVAV
  EPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKKKDEGSYSLEEPKQANGGAYQ
  KPTKQEEFYA

• Structural information:
  • Interpro: IPR003585  IPR001050  IPR031190  IPR027789  IPR030479  
  • Prosite: PS00964
  • PDB: 4GVC 4GVD 6EJE
  • PDBsum: 4GVC 4GVD 6EJE
  • DIP: 1123
  • STRING: ENSP00000370542
• Other Databases: GeneCards:  SDC1  Malacards:  SDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042060	wound healing	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051591	response to cAMP	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0042476	odontogenesis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0048627	myoblast development	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0060009	Sertoli cell development	IEA	biological process
GO:0051592	response to calcium ion	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0010033	response to organic substance	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903543	positive regulation of exosomal secretion	IMP	biological process
GO:1903553	positive regulation of extracellular exosome assembly	IMP	biological process
GO:0055002	striated muscle cell development	IEP	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0048627	myoblast development	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05205	Proteoglycans in cancer
hsa04514	Cell adhesion molecules
hsa05418	Fluid shear stress and atherosclerosis
hsa04512	ECM-receptor interaction
hsa05144	Malaria

Diseases

Associated diseases	References
Hyperglycemia	PMID:16810465
Hodgkin's lymphoma	PMID:9746758
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq