• Gene id: 6376

Gene Summary

• Gene Symbol: CX3CL1   Gene   UCSC   Ensembl
• Aliases: ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
• Gene name: C-X3-C motif chemokine ligand 1
• Alternate names: fractalkine, C-X3-C motif chemokine 1, CX3C membrane-anchored chemokine, chemokine (C-X3-C motif) ligand 1, small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin), small inducible cytokine subfamily D (Cys-X3-Cys), member-1,
• Gene location: 16q21 (57372457: 57385047)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, res
• OMIM: 601880

Protein Summary

• Protein general information: P78423  
  • Name: Fractalkine (C X3 C motif chemokine 1) (CX3C membrane anchored chemokine) (Neurotactin) (Small inducible cytokine D1) [Cleaved into: Processed fractalkine]
  • Length: 397  
  • Mass: 42,203
• Sequence:

  MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCA
  DPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEPTPSSQEAQRA
  LGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPS
  TQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
  PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMFTYQSLQGCPRKMAGE
  MAEGLRYIPRSCGSNSYVLVPV

• Structural information:
  • Interpro: IPR034127  IPR001811  IPR008097  IPR036048  
  • CDD: cd00274
  • PDB: 1B2T 1F2L 3ONA 4XT1 4XT3
  • PDBsum: 1B2T 1F2L 3ONA 4XT1 4XT3
  • DIP: 5878
  • STRING: ENSP00000006053
• Other Databases: GeneCards:  CX3CL1  Malacards:  CX3CL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IEA	biological process
GO:0001774	microglial cell activation	IEA	biological process
GO:0002052	positive regulation of neuroblast proliferation	IEA	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IMP	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005102	receptor binding	TAS	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	IDA	biological process
GO:0006935	chemotaxis	IMP	biological process
GO:0006952	defense response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007568	aging	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0008009	chemokine activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0010759	positive regulation of macrophage chemotaxis	IEA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0030595	leukocyte chemotaxis	TAS	biological process
GO:0031737	CX3C chemokine receptor binding	IDA	molecular function
GO:0032914	positive regulation of transforming growth factor beta1 production	IEA	biological process
GO:0033622	integrin activation	IMP	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045906	negative regulation of vasoconstriction	IEA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048246	macrophage chemotaxis	IEA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0050710	negative regulation of cytokine secretion	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEP	biological process
GO:0050902	leukocyte adhesive activation	TAS	biological process
GO:0051041	positive regulation of calcium-independent cell-cell adhesion	IDA	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0060080	inhibitory postsynaptic potential	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0001774	microglial cell activation	IEA	biological process
GO:0002052	positive regulation of neuroblast proliferation	IEA	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IMP	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005102	receptor binding	TAS	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0006935	chemotaxis	IMP	biological process
GO:0006952	defense response	TAS	biological process
GO:0006955	immune response	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007568	aging	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0008009	chemokine activity	IEA	molecular function
GO:0008009	chemokine activity	TAS	molecular function
GO:0008009	chemokine activity	IDA	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010759	positive regulation of macrophage chemotaxis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0030595	leukocyte chemotaxis	TAS	biological process
GO:0031737	CX3C chemokine receptor binding	IDA	molecular function
GO:0032914	positive regulation of transforming growth factor beta1 production	IEA	biological process
GO:0033622	integrin activation	IMP	biological process
GO:0042060	wound healing	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IEA	biological process
GO:0045906	negative regulation of vasoconstriction	IEA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048246	macrophage chemotaxis	IEA	biological process
GO:0048247	lymphocyte chemotaxis	IEA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0050710	negative regulation of cytokine secretion	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IEP	biological process
GO:0050902	leukocyte adhesive activation	IEA	biological process
GO:0050902	leukocyte adhesive activation	TAS	biological process
GO:0051041	positive regulation of calcium-independent cell-cell adhesion	IDA	biological process
GO:0060055	angiogenesis involved in wound healing	IEA	biological process
GO:0060080	inhibitory postsynaptic potential	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0098794	postsynapse	IEA	cellular component
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IMP	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005102	receptor binding	TAS	molecular function
GO:0005178	integrin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	IDA	biological process
GO:0006935	chemotaxis	IMP	biological process
GO:0006952	defense response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0008009	chemokine activity	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0030595	leukocyte chemotaxis	TAS	biological process
GO:0031737	CX3C chemokine receptor binding	IDA	molecular function
GO:0033622	integrin activation	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0050729	positive regulation of inflammatory response	IEP	biological process
GO:0050902	leukocyte adhesive activation	TAS	biological process
GO:0051041	positive regulation of calcium-independent cell-cell adhesion	IDA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04062	Chemokine signaling pathway
hsa05163	Human cytomegalovirus infection

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 17611763
Cancer	GAD: 17611763
Atherosclerosis	GAD: 19372452
Brain ischemia	GAD: 19729601
Psoriasis	GAD: 17002687
Asthma	GAD: 17505143
Alzheimer's disease	GAD: 19141999
Endometriosis	INFBASE: 16109418
Endometriosis	INFBASE: 23517860
Sperm motility	MIK: 12042278
Male factor infertility	MIK: 12042278
Asthenozoospermia	MIK: 12042278
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Asthenozoospermia	MIK: 12042278

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
12042278	Sperm motility, ASTHENOZOOSPERMIA			90 (58 infertile men with asthenozoospermia, 22 patients without asthenozoospermia, 10 FETILE DONORS)	Male infertility	fractalkine
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq