• Gene id: 6374

Gene Summary

• Gene Symbol: CXCL5   Gene   UCSC   Ensembl
• Aliases: ENA-78, SCYB5
• Gene name: C-X-C motif chemokine ligand 5
• Alternate names: C-X-C motif chemokine 5, chemokine (C-X-C motif) ligand 5, epithelial-derived neutrophil-activating protein 78, neutrophil-activating peptide ENA-78, neutrophil-activating protein 78, small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-deriv,
• Gene location: 4q13.3 (76023496: 76021117)     Exons: 4     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This protein is proposed to bind the G-protein co

Protein Summary

• Protein general information: P42830  
  • Name: C X C motif chemokine 5 (ENA 78(1 78)) (Epithelial derived neutrophil activating protein 78) (Neutrophil activating peptide ENA 78) (Small inducible cytokine B5) [Cleaved into: ENA 78(8 78); ENA 78(9 78)]
  • Length: 114  
  • Mass: 11972
• Sequence:

  MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQC
  SKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 2MGS
  • PDBsum: 2MGS
  • DIP: 5911
  • STRING: ENSP00000296027
• Other Databases: GeneCards:  CXCL5  Malacards:  CXCL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0042802	identical protein binding	IDA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04668	TNF signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis
hsa05133	Pertussis

Diseases

Associated diseases	References
Idiopathic pulmonary fibrosis	PMID:11751193
Idiopathic pulmonary fibrosis	PMID:20137269
Adult respiratory distress syndrome	PMID:8810593
pulmonary sarcoidosis	PMID:17052298
Diffuse scleroderma	PMID:18432520
Asthma	PMID:17234659
Chronic obstructive pulmonary disease	PMID:12857718
colorectal cancer	PMID:18413816
Hyperhomocysteinemia	PMID:11950713
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R