• Gene id: 6373

Gene Summary

• Gene Symbol: CXCL11   Gene   UCSC   Ensembl
• Aliases: H174, I-TAC, IP-9, IP9, SCYB11, SCYB9B, b-R1
• Gene name: C-X-C motif chemokine ligand 11
• Alternate names: C-X-C motif chemokine 11, beta-R1, chemokine (C-X-C motif) ligand 11, interferon gamma-inducible protein 9, interferon-inducible T-cell alpha chemoattractant, small inducible cytokine B11, small inducible cytokine subfamily B (Cys-X-Cys), member 11, small induci,
• Gene location: 4q21.1 (76036069: 76033681)     Exons: 4     NC_000004.12
• Gene summary(Entrez): Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chem
• OMIM: 604852

Protein Summary

• Protein general information: O14625  
  • Name: C X C motif chemokine 11 (Beta R1) (H174) (Interferon gamma inducible protein 9) (IP 9) (Interferon inducible T cell alpha chemoattractant) (I TAC) (Small inducible cytokine B11)
  • Length: 94  
  • Mass: 10365
  • Tissue specificity: High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin diso
• Sequence:

  MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCL
  NPKSKQARLIIKKVERKNF

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR027221   IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • PDB: 1RJT
  • PDBsum: 1RJT
  • DIP: 5890
  • STRING: ENSP00000306884
• Other Databases: GeneCards:  CXCL11  Malacards:  CXCL11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0048248	CXCR3 chemokine receptor binding	IDA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0042127	regulation of cell population proliferation	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0010818	T cell chemotaxis	IMP	biological process
GO:0008201	heparin binding	IMP	molecular function
GO:0070098	chemokine-mediated signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04620	Toll-like receptor signaling pathway

Diseases

Associated diseases	References
Allergic rhinitis	KEGG:H01360
Allergic rhinitis	KEGG:H01360
pulmonary sarcoidosis	PMID:17550373
Bronchiolitis obliterans	PMID:12097412
Chronic obstructive pulmonary disease	PMID:17925429
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)