• Gene id: 6372

Gene Summary

• Gene Symbol: CXCL6   Gene   UCSC   Ensembl
• Aliases: CKA-3, GCP-2, GCP2, SCYB6
• Gene name: C-X-C motif chemokine ligand 6
• Alternate names: C-X-C motif chemokine 6, Small inducible cytokine subfamily B (Cys-X-Cys), member b, chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2), chemokine alpha 3, granulocyte chemotactic protein 2, small inducible cytokine subfamily B (Cys-X-Cys), m,
• Gene location: 4q13.3 (73836677: 73838759)     Exons: 4     NC_000004.12
• OMIM: 138965

Protein Summary

• Protein general information: P80162  
  • Name: C X C motif chemokine 6 (Chemokine alpha 3) (CKA 3) (Granulocyte chemotactic protein 2) (GCP 2) (Small inducible cytokine B6) [Cleaved into: Small inducible cytokine B6, N processed variant 1; Small inducible cytokine B6, N processed variant 2; Small indu
  • Length: 114  
  • Mass: 11897
• Sequence:

  MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQC
  SKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN

• Structural information:
  • Interpro: IPR001089  IPR018048  IPR001811  IPR033899  IPR036048  
  • Prosite: PS00471
  • CDD: cd00273
  • STRING: ENSP00000226317
• Other Databases: GeneCards:  CXCL6  Malacards:  CXCL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071222	cellular response to lipopolysaccharide	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0045236	CXCR chemokine receptor binding	IBA	molecular function
GO:0030595	leukocyte chemotaxis	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0006952	defense response	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070951	regulation of neutrophil mediated killing of gram-negative bacterium	IEA	biological process
GO:0032642	regulation of chemokine production	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0001776	leukocyte homeostasis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0042119	neutrophil activation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04668	TNF signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis
hsa05133	Pertussis

Diseases

Associated diseases	References
Sleep apnea	PMID:15988615
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray