• Gene id: 6368

Gene Summary

• Gene Symbol: CCL23   Gene   UCSC   Ensembl
• Aliases: CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3, MIP3, MPIF-1, SCYA23, hmrp-2a
• Gene name: C-C motif chemokine ligand 23
• Alternate names: C-C motif chemokine 23, C6 beta-chemokine, chemokine (C-C motif) ligand 23, macrophage inflammatory protein 3, myeloid progenitor inhibitory factor 1, small inducible cytokine subfamily A (Cys-Cys), member 23,
• Gene location: 17q12 (36018178: 36013055)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the
• OMIM: 606250

Protein Summary

• Protein general information: P55773  
  • Name: C C motif chemokine 23 (CK beta 8) (CKB 8) (Macrophage inflammatory protein 3) (MIP 3) (Myeloid progenitor inhibitory factor 1) (MPIF 1) (Small inducible cytokine A23) [Cleaved into: CCL23(19 99); CCL23(22 99); CCL23(27 99); CCL23(30 99)]
  • Length: 120  
  • Mass: 13411
  • Tissue specificity: High levels in adult lung, liver, skeletal muscle and pancreas. Moderate levels in fetal liver, adult bone marrow and placenta. The short form is the major species and the longer form was detected only in very low abundance. CCL23(19-9
• Sequence:

  MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLESYFETN
  SECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 1G91
  • PDBsum: 1G91
• Other Databases: GeneCards:  CCL23  Malacards:  CCL23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0048245	eosinophil chemotaxis	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008009	chemokine activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0006874	cellular calcium ion homeostasis	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:2001264	negative regulation of C-C chemokine binding	IDA	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0048245	eosinophil chemotaxis	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008009	chemokine activity	TAS	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0006874	cellular calcium ion homeostasis	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:2001264	negative regulation of C-C chemokine binding	IDA	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881