• Gene id: 6367

Gene Summary

• Gene Symbol: CCL22   Gene   UCSC   Ensembl
• Aliases: A-152E5.1, ABCD-1, DC/B-CK, MDC, SCYA22, STCP-1
• Gene name: C-C motif chemokine ligand 22
• Alternate names: C-C motif chemokine 22, CC chemokine STCP-1, MDC(1-69), chemokine (C-C motif) ligand 22, macrophage-derived chemokine, small inducible cytokine A22, small inducible cytokine subfamily A (Cys-Cys), member 22, stimulated T cell chemotactic protein 1,
• Gene location: 16q21 (57358782: 57366188)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized
• OMIM: 602957

Protein Summary

• Protein general information: O00626  
  • Name: C C motif chemokine 22 (CC chemokine STCP 1) (MDC(1 69)) (Macrophage derived chemokine) (Small inducible cytokine A22) (Stimulated T cell chemotactic protein 1) [Cleaved into: MDC(3 69); MDC(5 69); MDC(7 69)]
  • Length: 93  
  • Mass: 10625
  • Tissue specificity: Highly expressed in macrophage and in monocyte-derived dendritic cells, and thymus. Also found in lymph node, appendix, activated monocytes, resting and activated macrophages. Lower expression in lung and spleen. Very weak expression i
• Sequence:

  MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEI
  CADPRVPWVKMILNKLSQ

• Structural information:
  • Interpro: IPR030598  IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • DIP: 5849
  • STRING: ENSP00000219235
• Other Databases: GeneCards:  CCL22  Malacards:  CCL22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0009615	response to virus	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
lung cancer	PMID:16453150
Bronchiolitis obliterans	PMID:20628341
Asthma	PMID:18684970
Chronic obstructive pulmonary disease	PMID:18684970
Pulmonary fibrosis	PMID:19715610
Rheumatoid arthritis	PMID:19942450
Osteoarthritis	PMID:19942450
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)