• Gene id: 6366

Gene Summary

• Gene Symbol: CCL21   Gene   UCSC   Ensembl
• Aliases: 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
• Gene name: C-C motif chemokine ligand 21
• Alternate names: C-C motif chemokine 21, Efficient Chemoattractant for Lymphocytes, beta chemokine exodus-2, chemokine (C-C motif) ligand 21, secondary lymphoid tissue chemokine, small inducible cytokine subfamily A (Cys-Cys), member 21,
• Gene location: 9p13.3 (34710135: 34709004)     Exons: 4     NC_000009.12
• Gene summary(Entrez): This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adj
• OMIM: 160740

Protein Summary

• Protein general information: O00585  
  • Name: C C motif chemokine 21 (6Ckine) (Beta chemokine exodus 2) (Secondary lymphoid tissue chemokine) (SLC) (Small inducible cytokine A21)
  • Length: 134  
  • Mass: 14646
  • Tissue specificity: Highly expressed in high endothelial venules of lymph nodes, spleen and appendix. Intermediate levels found in small intestine, thyroid gland and trachea. Low level expression in thymus, bone marrow, liver, and pancreas. Also found in
• Sequence:

  MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELC
  ADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP

• Structural information:
  • Interpro: IPR030593  IPR039809  IPR034133  IPR001811  IPR036048  
  • CDD: cd01119
  • PDB: 2L4N 5EKI
  • PDBsum: 2L4N 5EKI
  • DIP: 5854
  • STRING: ENSP00000259607
• Other Databases: GeneCards:  CCL21  Malacards:  CCL21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0042379	chemokine receptor binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0031732	CCR7 chemokine receptor binding	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:2000406	positive regulation of T cell migration	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0038116	chemokine (C-C motif) ligand 21 signaling pathway	ISS	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0031732	CCR7 chemokine receptor binding	ISS	molecular function
GO:0001768	establishment of T cell polarity	IDA	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IDA	biological process
GO:0090630	activation of GTPase activity	IDA	biological process
GO:0033630	positive regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0034695	response to prostaglandin E	IDA	biological process
GO:0035759	mesangial cell-matrix adhesion	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IDA	biological process
GO:0051491	positive regulation of filopodium assembly	IDA	biological process
GO:2000147	positive regulation of cell motility	IDA	biological process
GO:0008009	chemokine activity	ISS	molecular function
GO:0002407	dendritic cell chemotaxis	IDA	biological process
GO:0030838	positive regulation of actin filament polymerization	IDA	biological process
GO:0031274	positive regulation of pseudopodium assembly	IDA	biological process
GO:0031529	ruffle organization	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0090023	positive regulation of neutrophil chemotaxis	IDA	biological process
GO:2000669	negative regulation of dendritic cell apoptotic process	IDA	biological process
GO:2000529	positive regulation of myeloid dendritic cell chemotaxis	IDA	biological process
GO:0002606	positive regulation of dendritic cell antigen processing and presentation	ISS	biological process
GO:0010560	positive regulation of glycoprotein biosynthetic process	ISS	biological process
GO:0031295	T cell costimulation	ISS	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	ISS	biological process
GO:0050921	positive regulation of chemotaxis	ISS	biological process
GO:2000548	negative regulation of dendritic cell dendrite assembly	ISS	biological process
GO:0001771	immunological synapse formation	ISS	biological process
GO:0006954	inflammatory response	NAS	biological process
GO:0048469	cell maturation	ISS	biological process
GO:0097026	dendritic cell dendrite assembly	ISS	biological process
GO:0010820	positive regulation of T cell chemotaxis	ISS	biological process
GO:1990869	cellular response to chemokine	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0060326	cell chemotaxis	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0001954	positive regulation of cell-matrix adhesion	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:1903237	negative regulation of leukocyte tethering or rolling	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Pulmonary fibrosis	PMID:17717200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R