• Gene id: 6364

Gene Summary

• Gene Symbol: CCL20   Gene   UCSC   Ensembl
• Aliases: CKb4, Exodus, LARC, MIP-3-alpha, MIP-3a, MIP3A, SCYA20, ST38
• Gene name: C-C motif chemokine ligand 20
• Alternate names: C-C motif chemokine 20, CC chemokine LARC, beta chemokine exodus-1, chemokine (C-C motif) ligand 20, liver and activation-regulated chemokine, macrophage inflammatory protein 3 alpha, small inducible cytokine subfamily A (Cys-Cys), member 20, small-inducible cyt,
• Gene location: 2q36.3 (227813841: 227817555)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The pr
• OMIM: 601960

Protein Summary

• Protein general information: P78556  
  • Name: C C motif chemokine 20 (Beta chemokine exodus 1) (CC chemokine LARC) (Liver and activation regulated chemokine) (Macrophage inflammatory protein 3 alpha) (MIP 3 alpha) (Small inducible cytokine A20) [Cleaved into: CCL20(1 67); CCL20(1 64); CCL20(2 70)]
  • Length: 96  
  • Mass: 10762
  • Tissue specificity: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level). Expressed predominantly in the liver, lymph nodes, appendix, peripheral blood lymphocytes, and fetal lung. Low levels seen in thymus, prostate,
• Sequence:

  MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCA
  NPKQTWVKYIVRLLSKKVKNM

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR034133  IPR001811  IPR036048  
  • Prosite: PS00472
  • CDD: cd01119
  • PDB: 1M8A 2HCI 2JYO 5UR7
  • PDBsum: 1M8A 2HCI 2JYO 5UR7
  • DIP: 5864
  • STRING: ENSP00000351671
• Other Databases: GeneCards:  CCL20  Malacards:  CCL20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0031731	CCR6 chemokine receptor binding	IDA	molecular function
GO:0031731	CCR6 chemokine receptor binding	IDA	molecular function
GO:0035584	calcium-mediated signaling using intracellular calcium source	IDA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0060326	cell chemotaxis	IDA	biological process
GO:0072678	T cell migration	ISS	biological process
GO:0072679	thymocyte migration	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:2000406	positive regulation of T cell migration	IDA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0031731	CCR6 chemokine receptor binding	IEA	molecular function
GO:0072678	T cell migration	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0072679	thymocyte migration	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04668	TNF signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04657	IL-17 signaling pathway
hsa05323	Rheumatoid arthritis

Diseases

Associated diseases	References
Exanthem	PMID:18384452
Cutaneous T cell lymphoma	PMID:22048239
pancreatic cancer	PMID:10225458
Acrodermatitis	PMID:17606602
Asthma	PMID:18422729
Skin papilloma	PMID:21715145
Atopic dermatitis	PMID:11133838
systemic scleroderma	PMID:21742595
Psoriasis	PMID:10843722
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)