• Gene id: 6361

Gene Summary

• Gene Symbol: CCL17   Gene   UCSC   Ensembl
• Aliases: A-152E5.3, ABCD-2, SCYA17, TARC
• Gene name: C-C motif chemokine ligand 17
• Alternate names: C-C motif chemokine 17, CC chemokine TARC, T cell-directed CC chemokine, chemokine (C-C motif) ligand 17, small inducible cytokine subfamily A (Cys-Cys), member 17, small-inducible cytokine A17, thymus and activation-regulated chemokine,
• Gene location: 16q21 (57396075: 57416062)     Exons: 6     NC_000016.10
• Gene summary(Entrez): This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized
• OMIM: 186355

Protein Summary

• Protein general information: Q92583  
  • Name: C C motif chemokine 17 (CC chemokine TARC) (Small inducible cytokine A17) (Thymus and activation regulated chemokine)
  • Length: 94  
  • Mass: 10507
  • Tissue specificity: Expressed at high levels in thymus and at low levels in the lung, colon and small intestine.
• Sequence:

  MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSD
  PNNKRVKNAVKYLQSLERS

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 1NR2 1NR4 5WK3
  • PDBsum: 1NR2 1NR4 5WK3
  • DIP: 5842
  • STRING: ENSP00000219244
• Other Databases: GeneCards:  CCL17  Malacards:  CCL17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031729	CCR4 chemokine receptor binding	IEA	molecular function
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Sarcoidosis	PMID:17949965
Cystic fibrosis	PMID:18026571
Bronchiolitis obliterans	PMID:18785972
Asthma	PMID:20237293
Interstitial lung disease	PMID:18276722
Chronic obstructive pulmonary disease	PMID:18684970
Pulmonary fibrosis	PMID:19715610
Pulmonary eosinophilia	PMID:11956056
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq