• Gene id: 6360

Gene Summary

• Gene Symbol: CCL16   Gene   UCSC   Ensembl
• Aliases: CKb12, HCC-4, ILINCK, LCC-1, LEC, LMC, Mtn-1, NCC-4, NCC4, SCYA16, SCYL4
• Gene name: C-C motif chemokine ligand 16
• Alternate names: C-C motif chemokine 16, IL-10-inducible chemokine, chemokine (C-C motif) ligand 16, chemokine LEC, liver CC chemokine-1, liver-expressed chemokine, lymphocyte and monocyte chemoattractant, monotactin-1, new CC chemokine 4, small inducible cytokine subfamily A (Cys,
• Gene location: 17q12 (35983619: 35976492)     Exons: 5     NC_000017.11
• Gene summary(Entrez): This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines.
• OMIM: 601394

Protein Summary

• Protein general information: O15467  
  • Name: C C motif chemokine 16 (Chemokine CC 4) (HCC 4) (Chemokine LEC) (IL 10 inducible chemokine) (LCC 1) (Liver expressed chemokine) (Lymphocyte and monocyte chemoattractant) (LMC) (Monotactin 1) (MTN 1) (NCC 4) (Small inducible cytokine A16)
  • Length: 120  
  • Mass: 13600
  • Tissue specificity: Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
• Sequence:

  MKVSEAALSLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREV
  CTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 5LTL
  • PDBsum: 5LTL
  • DIP: 5831
  • STRING: ENSP00000478024
• Other Databases: GeneCards:  CCL16  Malacards:  CCL16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0007154	cell communication	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)