• Gene id: 6359

Gene Summary

• Gene Symbol: CCL15   Gene   UCSC   Ensembl
• Aliases: HCC-2, HMRP-2B, LKN-1, LKN1, MIP-1 delta, MIP-1D, MIP-5, MRP-2B, NCC-3, NCC3, SCYA15, SCYL3, SY15
• Gene name: C-C motif chemokine ligand 15
• Alternate names: C-C motif chemokine 15, chemokine (C-C motif) ligand 15, chemokine CC-2, leukotactin 1, macrophage inflammatory protein 5, new CC chemokine 3, small inducible cytokine subfamily A (Cys-Cys), member 15, small-inducible cytokine A15,
• Gene location: 17q12 (36001552: 35997581)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes
• OMIM: 603054

Protein Summary

• Protein general information: Q16663  
  • Name: C C motif chemokine 15 (Chemokine CC 2) (HCC 2) (Leukotactin 1) (LKN 1) (MIP 1 delta) (Macrophage inflammatory protein 5) (MIP 5) (Mrp 2b) (NCC 3) (Small inducible cytokine A15) [Cleaved into: CCL15(22 92); CCL15(25 92); CCL15(29 92)]
  • Length: 113  
  • Mass: 12248
  • Tissue specificity: Most abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients. {EC
• Sequence:

  MKVSVAALSCLMLVAVLGSQAQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSS
  ECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 2HCC
  • PDBsum: 2HCC
  • DIP: 6218
  • STRING: ENSP00000484078
• Other Databases: GeneCards:  CCL15  Malacards:  CCL15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0048245	eosinophil chemotaxis	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0006874	cellular calcium ion homeostasis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R