• Gene id: 6358

Gene Summary

• Gene Symbol: CCL14   Gene   UCSC   Ensembl
• Aliases: CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14
• Gene name: C-C motif chemokine ligand 14
• Alternate names: C-C motif chemokine 14, chemokine (C-C motif) ligand 14, chemokine CC-1/CC-3, chemokine CC-3, hemofiltrate CC chemokine 1, new CC chemokine 2, small inducible cytokine subfamily A (Cys-Cys), member 14, small-inducible cytokine A14,
• Gene location: 17q12 (35986728: 35983287)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calciu
• OMIM: 601392

Protein Summary

• Protein general information: Q16627  
  • Name: C C motif chemokine 14 (Chemokine CC 1/CC 3) (HCC 1/HCC 3) (HCC 1(1 74)) (NCC 2) (Small inducible cytokine A14) [Cleaved into: HCC 1(3 74); HCC 1(4 74); HCC 1(9 74)]
  • Length: 93  
  • Mass: 10678
  • Tissue specificity: Expressed constitutively in several normal tissues
• Sequence:

  MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVC
  TNPSDKWVQDYIKDMKEN

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 2Q8R 2Q8T
  • PDBsum: 2Q8R 2Q8T
  • DIP: 5861
• Other Databases: GeneCards:  CCL14  Malacards:  CCL14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0006874	cellular calcium ion homeostasis	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881