• Gene id: 6352

Gene Summary

• Gene Symbol: CCL5   Gene   UCSC   Ensembl
• Aliases: D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
• Gene name: C-C motif chemokine ligand 5
• Alternate names: C-C motif chemokine 5, T-cell specific protein p288, beta-chemokine RANTES, chemokine (C-C motif) ligand 5, eosinophil chemotactic cytokine, regulated upon activation, normally T-expressed, and presumably secreted, small inducible cytokine subfamily A (Cy,
• Gene location: 17q12 (25455310: 25460174)     Exons: 9     NC_000024.10
• Gene summary(Entrez): This gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the
• OMIM: 187011

Protein Summary

• Protein general information: P13501  
  • Name: C C motif chemokine 5 (EoCP) (Eosinophil chemotactic cytokine) (SIS delta) (Small inducible cytokine A5) (T cell specific protein P228) (TCP228) (T cell specific protein RANTES) [Cleaved into: RANTES(3 68); RANTES(4 68)]
  • Length: 91  
  • Mass: 9,990
• Sequence:

  MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCAN
  PEKKWVREYINSLEMS

• Structural information:
  • Interpro: IPR030595  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 1B3A 1EQT 1HRJ 1RTN 1RTO 1U4L 1U4M 1U4P 1U4R 2L9H 2VXW 5CMD 5COY 5DNF 5L2U 5UIW
  • PDBsum: 1B3A 1EQT 1HRJ 1RTN 1RTO 1U4L 1U4M 1U4P 1U4R 2L9H 2VXW 5CMD 5COY 5DNF 5L2U 5UIW
  • DIP: 31
  • STRING: ENSP00000293272
• Other Databases: GeneCards:  CCL5  Malacards:  CCL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	IMP	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0002544	chronic inflammatory response	IEA	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0002676	regulation of chronic inflammatory response	TAS	biological process
GO:0004435	phosphatidylinositol phospholipase C activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0006887	exocytosis	IDA	biological process
GO:0006935	chemotaxis	NAS	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0007568	aging	IEA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0008009	chemokine activity	NAS	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0009615	response to virus	TAS	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0009651	response to salt stress	IEA	biological process
GO:0010535	positive regulation of activation of JAK2 kinase activity	TAS	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0016004	phospholipase activator activity	IDA	molecular function
GO:0018894	dibenzo-p-dioxin metabolic process	IEA	biological process
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IDA	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0031328	positive regulation of cellular biosynthetic process	IDA	biological process
GO:0031584	activation of phospholipase D activity	IDA	biological process
GO:0031622	positive regulation of fever generation	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IDA	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	TAS	molecular function
GO:0031729	CCR4 chemokine receptor binding	TAS	molecular function
GO:0031730	CCR5 chemokine receptor binding	IPI	molecular function
GO:0032868	response to insulin	IEA	biological process
GO:0033634	positive regulation of cell-cell adhesion mediated by integrin	IDA	biological process
GO:0034112	positive regulation of homotypic cell-cell adhesion	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042119	neutrophil activation	IDA	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0043621	protein self-association	IDA	molecular function
GO:0043623	cellular protein complex assembly	IDA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0043922	negative regulation by host of viral transcription	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IEP	biological process
GO:0045070	positive regulation of viral genome replication	TAS	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045089	positive regulation of innate immune response	TAS	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0045744	negative regulation of G-protein coupled receptor protein signaling pathway	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045948	positive regulation of translational initiation	NAS	biological process
GO:0046427	positive regulation of JAK-STAT cascade	TAS	biological process
GO:0046817	chemokine receptor antagonist activity	IDA	molecular function
GO:0048245	eosinophil chemotaxis	IDA	biological process
GO:0048246	macrophage chemotaxis	TAS	biological process
GO:0048247	lymphocyte chemotaxis	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IBA	biological process
GO:0050796	regulation of insulin secretion	IDA	biological process
GO:0050863	regulation of T cell activation	IDA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0060754	positive regulation of mast cell chemotaxis	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IDA	biological process
GO:0070098	chemokine-mediated signaling pathway	TAS	biological process
GO:0070100	negative regulation of chemokine-mediated signaling pathway	IEA	biological process
GO:0070233	negative regulation of T cell apoptotic process	IDA	biological process
GO:0070234	positive regulation of T cell apoptotic process	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0070723	response to cholesterol	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0071307	cellular response to vitamin K	IEA	biological process
GO:0071315	cellular response to morphine	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEP	biological process
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0071361	cellular response to ethanol	IEA	biological process
GO:0071403	cellular response to high density lipoprotein particle stimulus	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0071448	cellular response to alkyl hydroperoxide	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:1901214	regulation of neuron death	IDA	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:2000110	negative regulation of macrophage apoptotic process	IEA	biological process
GO:2000406	positive regulation of T cell migration	IDA	biological process
GO:2000503	positive regulation of natural killer cell chemotaxis	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0002544	chronic inflammatory response	IEA	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0002676	regulation of chronic inflammatory response	TAS	biological process
GO:0004435	phosphatidylinositol phospholipase C activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005125	cytokine activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0006887	exocytosis	IDA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006935	chemotaxis	NAS	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006955	immune response	IEA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0007568	aging	IEA	biological process
GO:0008009	chemokine activity	IEA	molecular function
GO:0008009	chemokine activity	IEA	molecular function
GO:0008009	chemokine activity	IDA	molecular function
GO:0008009	chemokine activity	NAS	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0009615	response to virus	IEA	biological process
GO:0009615	response to virus	IEA	biological process
GO:0009615	response to virus	TAS	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0009651	response to salt stress	IEA	biological process
GO:0010535	positive regulation of activation of JAK2 kinase activity	TAS	biological process
GO:0010628	positive regulation of gene expression	IEA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0016004	phospholipase activator activity	IDA	molecular function
GO:0018894	dibenzo-p-dioxin metabolic process	IEA	biological process
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IDA	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0031328	positive regulation of cellular biosynthetic process	IDA	biological process
GO:0031584	activation of phospholipase D activity	IDA	biological process
GO:0031622	positive regulation of fever generation	IEA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0031726	CCR1 chemokine receptor binding	IEA	molecular function
GO:0031726	CCR1 chemokine receptor binding	IEA	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IDA	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	TAS	molecular function
GO:0031729	CCR4 chemokine receptor binding	IEA	molecular function
GO:0031729	CCR4 chemokine receptor binding	TAS	molecular function
GO:0031730	CCR5 chemokine receptor binding	IEA	molecular function
GO:0031730	CCR5 chemokine receptor binding	IPI	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0033634	positive regulation of cell-cell adhesion mediated by integrin	IDA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0034112	positive regulation of homotypic cell-cell adhesion	IDA	biological process
GO:0034612	response to tumor necrosis factor	IEA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042119	neutrophil activation	IDA	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0043621	protein self-association	IDA	molecular function
GO:0043623	cellular protein complex assembly	IDA	biological process
GO:0043627	response to estrogen	IEA	biological process
GO:0043922	negative regulation by host of viral transcription	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IEP	biological process
GO:0045070	positive regulation of viral genome replication	TAS	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045089	positive regulation of innate immune response	TAS	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0045672	positive regulation of osteoclast differentiation	IEA	biological process
GO:0045744	negative regulation of G-protein coupled receptor protein signaling pathway	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IEA	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045948	positive regulation of translational initiation	NAS	biological process
GO:0046427	positive regulation of JAK-STAT cascade	TAS	biological process
GO:0046817	chemokine receptor antagonist activity	IDA	molecular function
GO:0048245	eosinophil chemotaxis	IDA	biological process
GO:0048246	macrophage chemotaxis	TAS	biological process
GO:0048247	lymphocyte chemotaxis	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IBA	biological process
GO:0050796	regulation of insulin secretion	IDA	biological process
GO:0050863	regulation of T cell activation	IDA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0060754	positive regulation of mast cell chemotaxis	IEA	biological process
GO:0061098	positive regulation of protein tyrosine kinase activity	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IEA	biological process
GO:0070098	chemokine-mediated signaling pathway	IDA	biological process
GO:0070098	chemokine-mediated signaling pathway	TAS	biological process
GO:0070100	negative regulation of chemokine-mediated signaling pathway	IEA	biological process
GO:0070233	negative regulation of T cell apoptotic process	IDA	biological process
GO:0070234	positive regulation of T cell apoptotic process	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0070723	response to cholesterol	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071230	cellular response to amino acid stimulus	IEA	biological process
GO:0071307	cellular response to vitamin K	IEA	biological process
GO:0071315	cellular response to morphine	IEA	biological process
GO:0071345	cellular response to cytokine stimulus	IEA	biological process
GO:0071346	cellular response to interferon-gamma	IEP	biological process
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0071361	cellular response to ethanol	IEA	biological process
GO:0071396	cellular response to lipid	IEA	biological process
GO:0071403	cellular response to high density lipoprotein particle stimulus	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0071448	cellular response to alkyl hydroperoxide	IEA	biological process
GO:0071560	cellular response to transforming growth factor beta stimulus	IEA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IEA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:1901214	regulation of neuron death	IDA	biological process
GO:1901215	negative regulation of neuron death	IEA	biological process
GO:2000110	negative regulation of macrophage apoptotic process	IEA	biological process
GO:2000406	positive regulation of T cell migration	IDA	biological process
GO:2000503	positive regulation of natural killer cell chemotaxis	IDA	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0002407	dendritic cell chemotaxis	TAS	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0002676	regulation of chronic inflammatory response	TAS	biological process
GO:0004435	phosphatidylinositol phospholipase C activity	IDA	molecular function
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0006816	calcium ion transport	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0006887	exocytosis	IDA	biological process
GO:0006935	chemotaxis	NAS	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0007159	leukocyte cell-cell adhesion	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IDA	biological process
GO:0007267	cell-cell signaling	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0008009	chemokine activity	NAS	molecular function
GO:0009615	response to virus	TAS	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0010535	positive regulation of activation of JAK2 kinase activity	TAS	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0014911	positive regulation of smooth muscle cell migration	IDA	biological process
GO:0016004	phospholipase activator activity	IDA	molecular function
GO:0030298	receptor signaling protein tyrosine kinase activator activity	IDA	molecular function
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0031328	positive regulation of cellular biosynthetic process	IDA	biological process
GO:0031584	activation of phospholipase D activity	IDA	biological process
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IDA	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	TAS	molecular function
GO:0031729	CCR4 chemokine receptor binding	TAS	molecular function
GO:0031730	CCR5 chemokine receptor binding	IPI	molecular function
GO:0033634	positive regulation of cell-cell adhesion mediated by integrin	IDA	biological process
GO:0034112	positive regulation of homotypic cell-cell adhesion	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0042119	neutrophil activation	IDA	biological process
GO:0042327	positive regulation of phosphorylation	IDA	biological process
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0042379	chemokine receptor binding	IPI	molecular function
GO:0042531	positive regulation of tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0043621	protein self-association	IDA	molecular function
GO:0043623	cellular protein complex assembly	IDA	biological process
GO:0043922	negative regulation by host of viral transcription	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IEP	biological process
GO:0045070	positive regulation of viral genome replication	TAS	biological process
GO:0045071	negative regulation of viral genome replication	IDA	biological process
GO:0045089	positive regulation of innate immune response	TAS	biological process
GO:0045744	negative regulation of G-protein coupled receptor protein signaling pathway	IDA	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045948	positive regulation of translational initiation	NAS	biological process
GO:0046427	positive regulation of JAK-STAT cascade	TAS	biological process
GO:0046817	chemokine receptor antagonist activity	IDA	molecular function
GO:0048245	eosinophil chemotaxis	IDA	biological process
GO:0048246	macrophage chemotaxis	TAS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IDA	biological process
GO:0050729	positive regulation of inflammatory response	IBA	biological process
GO:0050796	regulation of insulin secretion	IDA	biological process
GO:0050863	regulation of T cell activation	IDA	biological process
GO:0051262	protein tetramerization	IDA	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0070098	chemokine-mediated signaling pathway	IDA	biological process
GO:0070098	chemokine-mediated signaling pathway	TAS	biological process
GO:0070233	negative regulation of T cell apoptotic process	IDA	biological process
GO:0070234	positive regulation of T cell apoptotic process	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IEP	biological process
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:1901214	regulation of neuron death	IDA	biological process
GO:2000406	positive regulation of T cell migration	IDA	biological process
GO:2000503	positive regulation of natural killer cell chemotaxis	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04060	Cytokine-cytokine receptor interaction
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway
hsa04062	Chemokine signaling pathway
hsa05323	Rheumatoid arthritis
hsa05020	Prion diseases
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa05164	Influenza A
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05142	Chagas disease

Diseases

Associated diseases	References
Cancer (meningeal)	GAD: 20406964
Cancer (pancreatic)	GAD: 16614115
Cancer (prostate)	GAD: 19099590
Cancer (Renal cell)	GAD: 19658300
Cancer (stomach)	GAD: 18306985
Cancer (thyroid)	GAD: 19730683
Cancer	GAD: 18306985
Cancer (bladder)	GAD: 19692168
Cancer (Central nervous system)	GAD: 20299965
Cancer (esophageal)	GAD: 20453000
Cancer (lung)	GAD: 18676680
Cancer (lymphoma)	GAD: 20038229
Atherosclerosis	GAD: 16799229
Cardiovascular disease	GAD: 11500196
Cerebral infarction	GAD: 17016617
Hypertension	GAD: 19349390
Uveitis	GAD: 17417600
Eye diseases	GAD: 18447907
Anemia	GAD: 19425063
Sarcoidosis	GAD: 11844139
Allergy	GAD: 15064621
Arthritis	GAD: 19333930
Asthma	GAD: 11544456
Inflammation	GAD: 17989610
Celiac disease	GAD: 16078996
Rheumatoid arthritis	GAD: 15971427
Multiple sclerosis	GAD: 15471370
Periodontitis	GAD: 17305874
Systemic lupus erythematosus (SLE)	GAD: 15468376
Allergic rhinitis	KEGG: H01360
Behcet's disease	GAD: 14651522
Asthma	GAD: 11197694
Atopy	GAD: 10640782
Obesity	GAD: 20734064
Diabetes	GAD: 12610055
Giant cell arteritis	GAD: 15742444
Alzheimer's disease	GAD: 15488313
Chronic renal failure	GAD: 21085059
Kidney diseases	GAD: 19578796
Endometriosis	INFBASE: 23474119
Endometriosis	GAD: 12837926
Female infertility	INFBASE: 11160842
Immunoinfertility	MIK: 11076090
Chronic obstructive pulmonary disease (COPD)	GAD: 16864713
Wegener granulomatosis	GAD: 12858455
Nasal polyposis	GAD: 10942140
Erythema	GAD: 19646363
Dermatitis	GAD: 17117952
Atopic dermatitis	KEGG: H01358
Albuminuria	GAD: 18217191
Nephropathy	GAD: 12610055
Immunoinfertility	MIK: 11076090
Male infertility	MIK: 11076090

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
11076090	Immunoinfertility, male infertility			84 (28 fertile, 35 male-factor infertile, 25 immunoinfertile)	Male infertility