• Gene id: 6348

Gene Summary

• Gene Symbol: CCL3   Gene   UCSC   Ensembl
• Aliases: G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3
• Gene name: C-C motif chemokine ligand 3
• Alternate names: C-C motif chemokine 3, G0/G1 switch regulatory protein 19-1, PAT 464.1, SIS-beta, macrophage inflammatory protein 1-alpha, small inducible cytokine A3 (homologous to mouse Mip-1a), tonsillar lymphocyte LD78 alpha protein,
• Gene location: 17q12 (21428082: 21514821)     Exons: 10     NC_000007.14
• Gene summary(Entrez): This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be a
• OMIM: 182283

Protein Summary

• Protein general information: P10147  
  • Name: C C motif chemokine 3 (G0/G1 switch regulatory protein 19 1) (Macrophage inflammatory protein 1 alpha) (MIP 1 alpha) (PAT 464.1) (SIS beta) (Small inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP 1 alpha(4 69) (LD78 alph
  • Length: 92  
  • Mass: 10085
• Sequence:

  MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCAD
  PSEEWVQKYVSDLELSA

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 1B50 1B53 2X69 2X6G 3FPU 3H44 3KBX 4RA8 4ZKB 5COR 5D65
  • PDBsum: 1B50 1B53 2X69 2X6G 3FPU 3H44 3KBX 4RA8 4ZKB 5COR 5D65
  • DIP: 5837
  • STRING: ENSP00000477908
• Other Databases: GeneCards:  CCL3  Malacards:  CCL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903980	positive regulation of microglial cell activation	TAS	biological process
GO:1904141	positive regulation of microglial cell migration	TAS	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0008009	chemokine activity	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0048245	eosinophil chemotaxis	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0006954	inflammatory response	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090280	positive regulation of calcium ion import	TAS	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0070723	response to cholesterol	IDA	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IDA	biological process
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0008360	regulation of cell shape	IDA	biological process
GO:0050795	regulation of behavior	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0006816	calcium ion transport	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:2000503	positive regulation of natural killer cell chemotaxis	IDA	biological process
GO:0071621	granulocyte chemotaxis	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0051930	regulation of sensory perception of pain	IDA	biological process
GO:0048247	lymphocyte chemotaxis	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0031663	lipopolysaccharide-mediated signaling pathway	IDA	biological process
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006954	inflammatory response	IDA	biological process
GO:0006935	chemotaxis	IDA	biological process
GO:0004672	protein kinase activity	IDA	molecular function
GO:0002548	monocyte chemotaxis	IDA	biological process
GO:0002548	monocyte chemotaxis	IC	biological process
GO:0051928	positive regulation of calcium ion transport	IDA	biological process
GO:0048245	eosinophil chemotaxis	IDA	biological process
GO:0043922	negative regulation by host of viral transcription	IDA	biological process
GO:0030502	negative regulation of bone mineralization	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0016301	kinase activity	IDA	molecular function
GO:0016004	phospholipase activator activity	IDA	molecular function
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0008009	chemokine activity	IDA	molecular function
GO:0008009	chemokine activity	IDA	molecular function
GO:0007267	cell-cell signaling	IDA	biological process
GO:0007010	cytoskeleton organization	IDA	biological process
GO:0006874	cellular calcium ion homeostasis	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0004698	calcium-dependent protein kinase C activity	IDA	molecular function
GO:0071407	cellular response to organic cyclic compound	IDA	biological process
GO:0043308	eosinophil degranulation	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0019722	calcium-mediated signaling	IDA	biological process
GO:0014808	release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	biological process
GO:0010818	T cell chemotaxis	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0006887	exocytosis	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0001775	cell activation	IDA	biological process
GO:0071356	cellular response to tumor necrosis factor	IEP	biological process
GO:0048246	macrophage chemotaxis	ISS	biological process
GO:0001649	osteoblast differentiation	IEP	biological process
GO:0071347	cellular response to interleukin-1	IEP	biological process
GO:0050718	positive regulation of interleukin-1 beta secretion	ISS	biological process
GO:0031730	CCR5 chemokine receptor binding	IPI	molecular function
GO:0031730	CCR5 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0023052	signaling	IEP	biological process
GO:0000165	MAPK cascade	IMP	biological process
GO:0071346	cellular response to interferon-gamma	IEP	biological process
GO:0050850	positive regulation of calcium-mediated signaling	IMP	biological process
GO:0050729	positive regulation of inflammatory response	ISS	biological process
GO:0043615	astrocyte cell migration	ISS	biological process
GO:0043491	protein kinase B signaling	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IEP	biological process
GO:0043525	positive regulation of neuron apoptotic process	ISS	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0031726	CCR1 chemokine receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000165	MAPK cascade	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor
hsa04620	Toll-like receptor signaling pathway
hsa05142	Chagas disease
hsa05323	Rheumatoid arthritis

Diseases

Associated diseases	References
focal segmental glomerulosclerosis	PMID:17684420
systemic scleroderma	PMID:21285114
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)