• Gene id: 6346

Gene Summary

• Gene Symbol: CCL1   Gene   UCSC   Ensembl
• Aliases: I-309, P500, SCYA1, SISe, TCA3
• Gene name: C-C motif chemokine ligand 1
• Alternate names: C-C motif chemokine 1, T lymphocyte-secreted protein I-309, chemokine (C-C motif) ligand 1, inflammatory cytokine I-309, small inducible cytokine A1 (I-309, homologous to mouse Tca-3),
• Gene location: 17q12 (34363232: 34360327)     Exons: 3     NC_000017.11
• Gene summary(Entrez): This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies
• OMIM: 182281

Protein Summary

• Protein general information: P22362  
  • Name: C C motif chemokine 1 (Small inducible cytokine A1) (T lymphocyte secreted protein I 309)
  • Length: 96  
  • Mass: 10992
• Sequence:

  MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACAL
  DTVGWVQRHRKMLRHCPSKRK

• Structural information:
  • Interpro: IPR039809  IPR000827  IPR001811  IPR036048  
  • Prosite: PS00472
  • PDB: 1EL0 4OIJ 4OIK
  • PDBsum: 1EL0 4OIJ 4OIK
  • DIP: 5835
  • STRING: ENSP00000225842
• Other Databases: GeneCards:  CCL1  Malacards:  CCL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071356	cellular response to tumor necrosis factor	IBA	biological process
GO:0071346	cellular response to interferon-gamma	IBA	biological process
GO:0070098	chemokine-mediated signaling pathway	IBA	biological process
GO:0048245	eosinophil chemotaxis	IBA	biological process
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0008009	chemokine activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0071347	cellular response to interleukin-1	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0048247	lymphocyte chemotaxis	IBA	biological process
GO:0048020	CCR chemokine receptor binding	IBA	molecular function
GO:0043547	positive regulation of GTPase activity	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0002548	monocyte chemotaxis	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0016032	viral process	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0006874	cellular calcium ion homeostasis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:1905078	positive regulation of interleukin-17 secretion	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0008009	chemokine activity	IDA	molecular function
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Multiple sclerosis	PMID:19865101
Asthma	PMID:20455898
Chronic obstructive pulmonary disease	PMID:16864713
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881