• Gene id: 6344

Gene Summary

• Gene Symbol: SCTR   Gene   UCSC   Ensembl
• Aliases: SR
• Gene name: secretin receptor
• Alternate names: secretin receptor, pancreatic secretin receptor,
• Gene location: 2q14.2 (119524482: 119439842)     Exons: 16     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its r
• OMIM: 617212

Protein Summary

• Protein general information: P47872  
  • Name: Secretin receptor (SCT R)
  • Length: 440  
  • Mass: 50207
• Sequence:

  MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISC
  WPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGY
  SSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYC
  IMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRG
  PVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELA
  LGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII

• Structural information:
  • Interpro: IPR017981  IPR036445  IPR001879  IPR000832  IPR017983   IPR002144  
  • Prosite: PS00649 PS00650 PS50227 PS50261
  • STRING: ENSP00000019103
• Other Databases: GeneCards:  SCTR  Malacards:  SCTR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0015055	secretin receptor activity	IBA	molecular function
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0007420	brain development	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0043950	positive regulation of cAMP-mediated signaling	ISS	biological process
GO:0032098	regulation of appetite	ISS	biological process
GO:0002024	diet induced thermogenesis	ISS	biological process
GO:0031667	response to nutrient levels	ISS	biological process
GO:0009992	cellular water homeostasis	ISS	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0015055	secretin receptor activity	IDA	molecular function
GO:0017046	peptide hormone binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04972	Pancreatic secretion
hsa04976	Bile secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq