• Gene id: 6343

Gene Summary

• Gene Symbol: SCT   Gene   UCSC   Ensembl
• Gene name: secretin
• Alternate names: secretin, prepro-secretin,
• Gene location: 11p15.5 (627691: 626094)     Exons: 5     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the glucagon family of peptides. The encoded preproprotein is secreted by endocrine S cells in the proximal small intestinal mucosa as a prohormone, then proteolytically processed to generate the mature peptide hormone. The r
• OMIM: 128239

Protein Summary

• Protein general information: P09683  
  • Name: Secretin
  • Length: 121  
  • Mass: 13016
• Sequence:

  MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTRLSAGL
  LCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR

• Structural information:
  • Interpro: IPR000532  IPR015675  
  • Prosite: PS00260
  • STRING: ENSP00000176195
• Other Databases: GeneCards:  SCT  Malacards:  SCT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903640	negative regulation of gastrin-induced gastric acid secretion	IBA	biological process
GO:0090274	positive regulation of somatostatin secretion	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0090187	positive regulation of pancreatic juice secretion	IBA	biological process
GO:0007420	brain development	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0021766	hippocampus development	ISS	biological process
GO:0002024	diet induced thermogenesis	ISS	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0032098	regulation of appetite	ISS	biological process
GO:0050996	positive regulation of lipid catabolic process	ISS	biological process
GO:0031667	response to nutrient levels	ISS	biological process
GO:0046659	digestive hormone activity	ISS	molecular function
GO:0005179	hormone activity	ISS	molecular function
GO:0009992	cellular water homeostasis	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0043950	positive regulation of cAMP-mediated signaling	IEA	biological process
GO:0090274	positive regulation of somatostatin secretion	IEA	biological process
GO:1903640	negative regulation of gastrin-induced gastric acid secretion	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0007420	brain development	IEA	biological process
GO:0009992	cellular water homeostasis	IEA	biological process
GO:0046659	digestive hormone activity	IEA	molecular function
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0048566	embryonic digestive tract development	IEA	biological process
GO:0090187	positive regulation of pancreatic juice secretion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0030157	pancreatic juice secretion	NAS	biological process
GO:0005179	hormone activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04972	Pancreatic secretion
hsa04976	Bile secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881