• Gene id: 6341

Gene Summary

• Gene Symbol: SCO1   Gene   UCSC   Ensembl
• Aliases: SCOD1
• Gene name: synthesis of cytochrome C oxidase 1
• Alternate names: protein SCO1 homolog, mitochondrial, SCO cytochrome c oxidase assembly protein 1, SCO cytochrome oxidase deficient homolog 1, SCO1, cytochrome c oxidase assembly protein,
• Gene location: 17p13.1 (10697532: 10672473)     Exons: 6     NC_000017.11
• Gene summary(Entrez): Mammalian cytochrome c oxidase (COX) catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytoch
• OMIM: 603644

Protein Summary

• Protein general information: O75880  
  • Name: Protein SCO1 homolog, mitochondrial
  • Length: 301  
  • Mass: 33814
  • Tissue specificity: Predominantly expressed in tissues characterized by high rates of oxidative phosphorylation (OxPhos), including muscle, heart, and brain. {ECO
• Sequence:

  MAMLVLVPGRVMRPLGGQLWRFLPRGLEFWGPAEGTARVLLRQFCARQAEAWRASGRPGYCLGTRPLSTARPPPP
  WSQKGPGDSTRPSKPGPVSWKSLAITFAIGGALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERK
  TDKDYLGQWLLIYFGFTHCPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLV
  GLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKK
  S

• Structural information:
  • Interpro: IPR003782  IPR017276  IPR036249  
  • CDD: cd02968
  • PDB: 1WP0 2GGT 2GQK 2GQL 2GQM 2GT5 2GT6 2GVP 2HRF 2HRN
  • PDBsum: 1WP0 2GGT 2GQK 2GQL 2GQM 2GT5 2GT6 2GVP 2HRF 2HRN
  • DIP: 46086
  • STRING: ENSP00000255390
• Other Databases: GeneCards:  SCO1  Malacards:  SCO1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033617	mitochondrial cytochrome c oxidase assembly	IBA	biological process
GO:0031305	integral component of mitochondrial inner membrane	IDA	cellular component
GO:0072492	host cell mitochondrial intermembrane space	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033617	mitochondrial cytochrome c oxidase assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005507	copper ion binding	IEA	molecular function
GO:0006825	copper ion transport	IEA	biological process
GO:0008535	respiratory chain complex IV assembly	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0006878	cellular copper ion homeostasis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0030016	myofibril	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901799	negative regulation of proteasomal protein catabolic process	IEA	biological process
GO:0033617	mitochondrial cytochrome c oxidase assembly	IEA	biological process
GO:0006878	cellular copper ion homeostasis	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Cytochrome c oxidase	KEGG:H01368
Cytochrome c oxidase	KEGG:H01368
Cytochrome-c oxidase deficiency disease	PMID:11013136
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)