• Gene id: 634

Gene Summary

• Gene Symbol: CEACAM1   Gene   UCSC   Ensembl
• Aliases: BGP, BGP1, BGPI
• Gene name: CEA cell adhesion molecule 1
• Alternate names: carcinoembryonic antigen-related cell adhesion molecule 1, CD66a antigen, antigen CD66, carcinoembryonic antigen related cell adhesion molecule 1, carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein),
• Gene location: 19q13.2 (42528481: 42507305)     Exons: 10     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a
• OMIM: 605596

Protein Summary

• Protein general information: P13688  
  • Name: Carcinoembryonic antigen related cell adhesion molecule 1 (Biliary glycoprotein 1) (BGP 1) (CD antigen CD66a)
  • Length: 526  
  • Mass: 57560
  • Tissue specificity: Expressed in columnar epithelial cells of the colon (at protein level) (PubMed
• Sequence:

  MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQQLFGYSWYKGERVDG
  NRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSIS
  SNNSNPVEDKDAVAFTCEPETQDTTYLWWINNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANR
  SDPVTLNVTYGPDTPTISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH
  ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWFFKNQSLPSSERMKLS
  QGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALPQENGLSPGAIAGIVIGVVALVALIAVALAC
  FLHFGKTGRASDQRDLTEHKPSVSNHTQDHSNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKK
  Q

• Structural information:
  • Protein Domains: (35..14-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000250|UniProtKB:P31997-)
    (145..23-)
    1 (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114-)
    (237..31-)
    2 (/note="Ig-like-C2-type)
    (/evidence="ECO:0000255|PROSIT-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  IPR013151  
  • Prosite: PS50835
  • PDB: 2GK2 4QXW 4WHD 5DZL 6AW2 6GBG 6GBH
  • PDBsum: 2GK2 4QXW 4WHD 5DZL 6AW2 6GBG 6GBH
  • DIP: 42683
  • STRING: ENSP00000161559
• Other Databases: GeneCards:  CEACAM1  Malacards:  CEACAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043318	negative regulation of cytotoxic T cell degranulation	IDA	biological process
GO:0001915	negative regulation of T cell mediated cytotoxicity	IDA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IDA	biological process
GO:0042101	T cell receptor complex	IDA	colocalizes with
GO:0030054	cell junction	IDA	cellular component
GO:0044319	wound healing, spreading of cells	IDA	biological process
GO:0030334	regulation of cell migration	IDA	biological process
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0003779	actin binding	IPI	molecular function
GO:0005516	calmodulin binding	ISS	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:1903385	regulation of homophilic cell adhesion	ISS	biological process
GO:0016328	lateral plasma membrane	ISS	cellular component
GO:0098742	cell-cell adhesion via plasma-membrane adhesion molecules	ISS	biological process
GO:0015125	bile acid transmembrane transporter activity	ISS	molecular function
GO:0015721	bile acid and bile salt transport	ISS	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0030054	cell junction	ISS	cellular component
GO:0005912	adherens junction	ISS	cellular component
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0030853	negative regulation of granulocyte differentiation	ISS	biological process
GO:0051055	negative regulation of lipid biosynthetic process	ISS	biological process
GO:0045601	regulation of endothelial cell differentiation	ISS	biological process
GO:0045717	negative regulation of fatty acid biosynthetic process	ISS	biological process
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	ISS	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	ISS	biological process
GO:0001558	regulation of cell growth	ISS	biological process
GO:0032692	negative regulation of interleukin-1 production	ISS	biological process
GO:0043116	negative regulation of vascular permeability	ISS	biological process
GO:0031005	filamin binding	IPI	molecular function
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:1990782	protein tyrosine kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002859	negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	biological process
GO:0007155	cell adhesion	ISS	biological process
GO:0007155	cell adhesion	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0009925	basal plasma membrane	ISS	cellular component
GO:0046983	protein dimerization activity	ISS	molecular function
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	ISS	biological process
GO:0038016	insulin receptor internalization	ISS	biological process
GO:0038158	granulocyte colony-stimulating factor signaling pathway	ISS	biological process
GO:0035726	common myeloid progenitor cell proliferation	ISS	biological process
GO:0009986	cell surface	ISS	cellular component
GO:0090331	negative regulation of platelet aggregation	ISS	biological process
GO:1901143	insulin catabolic process	ISS	biological process
GO:1903670	regulation of sprouting angiogenesis	ISS	biological process
GO:0060312	regulation of blood vessel remodeling	ISS	biological process
GO:0010594	regulation of endothelial cell migration	ISS	biological process
GO:2000346	negative regulation of hepatocyte proliferation	ISS	biological process
GO:1901143	insulin catabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2001214	positive regulation of vasculogenesis	ISS	biological process
GO:0006469	negative regulation of protein kinase activity	ISS	biological process
GO:0001568	blood vessel development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000346	negative regulation of hepatocyte proliferation	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035579	specific granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005912	adherens junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031528	microvillus membrane	IEA	cellular component
GO:0030658	transport vesicle membrane	IEA	cellular component
GO:0009925	basal plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	NAS	biological process
GO:0016477	cell migration	NAS	biological process
GO:0007229	integrin-mediated signaling pathway	NAS	biological process
GO:0001525	angiogenesis	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq