• Gene id: 633

Gene Summary

• Gene Symbol: BGN   Gene   UCSC   Ensembl
• Aliases: DSPG1, MRLS, PG-S1, PGI, SEMDX, SLRR1A
• Gene name: biglycan
• Alternate names: biglycan, bone/cartilage proteoglycan-I, dermatan sulphate proteoglycan I, small leucine-rich protein 1A,
• Gene location: Xq28 (153494979: 153509545)     Exons: 9     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in bone growth, muscle development and regeneration, and
• OMIM: 301870

Protein Summary

• Protein general information: P21810  
  • Name: Biglycan (Bone/cartilage proteoglycan I) (PG S1)
  • Length: 368  
  • Mass: 41654
  • Tissue specificity: Found in several connective tissues, especially in articular cartilages.
• Sequence:

  MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQ
  CSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHL
  VEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPK
  DLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLK
  LLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK

• Structural information:
  • Interpro: IPR028547  IPR001611  IPR003591  IPR032675  IPR000372   IPR016352  
  • Prosite: PS51450
  • STRING: ENSP00000327336
• Other Databases: GeneCards:  BGN  Malacards:  BGN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030206	chondroitin sulfate biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0030207	chondroitin sulfate catabolic process	TAS	biological process
GO:0030208	dermatan sulfate biosynthetic process	TAS	biological process
GO:0030133	transport vesicle	IDA	cellular component
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0061975	articular cartilage development	IEA	biological process
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	IEA	biological process
GO:0060348	bone development	IEA	biological process
GO:0042383	sarcolemma	IEA	cellular component
GO:0005539	glycosaminoglycan binding	IEA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	ISS	molecular function
GO:0030021	extracellular matrix structural constituent conferring compression resistance	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	colocalizes with
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0031012	extracellular matrix	NAS	cellular component
GO:0005201	extracellular matrix structural constituent	NAS	molecular function

Diseases

Associated diseases	References
Spondyloepimetaphyseal dysplasia	KEGG:H02187
Spondyloepimetaphyseal dysplasia	KEGG:H02187
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881