• Gene id: 6317

Gene Summary

• Gene Symbol: SERPINB3   Gene   UCSC   Ensembl
• Aliases: HsT1196, SCC, SCCA-1, SCCA-PD, SCCA1, SSCA1, T4-A
• Gene name: serpin family B member 3
• Alternate names: serpin B3, protein T4-A, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, squamous cell carcinoma antigen 1,
• Gene location: 18q21.33 (63661892: 63655196)     Exons: 8     NC_000018.10
• OMIM: 600517

Protein Summary

• Protein general information: P29508  
  • Name: Serpin B3 (Protein T4 A) (Squamous cell carcinoma antigen 1) (SCCA 1)
  • Length: 390  
  • Mass: 44565
  • Tissue specificity: Squamous cells. Expressed in some hepatocellular carcinoma (at protein level). {ECO
• Sequence:

  MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHV
  DRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSW
  VESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLE
  DVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLR
  TMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQ
  NKTNSILFYGRFSSP

• Structural information:
  • Interpro: IPR023795  IPR023796  IPR000215  IPR036186  IPR042178   IPR042185  
  • Prosite: PS00284
  • PDB: 2ZV6 4ZK0 4ZK3
  • PDBsum: 2ZV6 4ZK0 4ZK3
  • STRING: ENSP00000283752
• Other Databases: GeneCards:  SERPINB3  Malacards:  SERPINB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IBA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0043086	negative regulation of catalytic activity	IDA	biological process
GO:0001618	virus receptor activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0010950	positive regulation of endopeptidase activity	IDA	biological process
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0010466	negative regulation of peptidase activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0045861	negative regulation of proteolysis	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0031982	vesicle	HDA	cellular component
GO:0035425	autocrine signaling	IMP	biological process
GO:0038001	paracrine signaling	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0043508	negative regulation of JUN kinase activity	IMP	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	NAS	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0010718	positive regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0010951	negative regulation of endopeptidase activity	IMP	biological process
GO:0004869	cysteine-type endopeptidase inhibitor activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05146	Amoebiasis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881