• Gene id: 63036

Gene Summary

• Gene Symbol: CELA2A   Gene   UCSC   Ensembl
• Aliases: AOMS4, ELA2A, PE-1
• Gene name: chymotrypsin like elastase 2A
• Alternate names: chymotrypsin-like elastase family member 2A, chymotrypsin like elastase family member 2A, elastase 2A, pancreatic elastase 2, pancreatic elastase IIA,
• Gene location: 1p36.21 (15456731: 15472090)     Exons: 8     NC_000001.11
• Gene summary(Entrez): Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase
• OMIM: 609443

Protein Summary

• Protein general information: P08217  
  • Name: Chymotrypsin like elastase family member 2A (EC 3.4.21.71) (Elastase 2A)
  • Length: 269  
  • Mass: 28888
  • Tissue specificity: Pancreas. Not detected in keratinocytes. {ECO
• Sequence:

  MIRTLLLSTLVAGALSCGDPTYPPYVTRVVGGEEARPNSWPWQVSLQYSSNGKWYHTCGGSLIANSWVLTAAHCI
  SSSRTYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILP
  NNYPCYVTGWGRLQTNGAVPDVLQQGRLLVVDYATCSSSAWWGSSVKTSMICAGGDGVISSCNGDSGGPLNCQAS
  DGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDWINSVIANN

• Structural information:
  • Protein Domains: (29..26-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • STRING: ENSP00000352639
• Other Databases: GeneCards:  CELA2A  Malacards:  CELA2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IBA	molecular function
GO:0005576	extracellular region	IDA	cellular component
GO:0032868	response to insulin	IDA	biological process
GO:0090330	regulation of platelet aggregation	IDA	biological process
GO:1901143	insulin catabolic process	IDA	biological process
GO:0050796	regulation of insulin secretion	IDA	biological process
GO:0004175	endopeptidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0004252	serine-type endopeptidase activity	TAS	molecular function
GO:0036457	keratohyalin granule	IDA	cellular component
GO:0017171	serine hydrolase activity	IDA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0070268	cornification	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Abdominal obesity-metabolic syndrome	KEGG:H02384
Abdominal obesity-metabolic syndrome	KEGG:H02384
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)