About Us

Search Result


Gene id 6303
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol SAT1   Gene   UCSC   Ensembl
Aliases DC21, KFSD, KFSDX, SAT, SSAT, SSAT-1
Gene name spermidine/spermine N1-acetyltransferase 1
Alternate names diamine acetyltransferase 1, diamine N-acetyltransferase 1, epididymis secretory sperm binding protein, polyamine N-acetyltransferase 1, putrescine acetyltransferase, spermidine/spermine N1-acetyltransferase alpha,
Gene location Xp22.11 (194136147: 194138731)     Exons: 4     NC_000003.12
Gene summary(Entrez) The protein encoded by this gene belongs to the acetyltransferase family, and is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the acetylation of spermidine and spermine, and is involved in the regulation of the int
OMIM 313020

Protein Summary

Protein general information P21673  

Name: Diamine acetyltransferase 1 (EC 2.3.1.57) (Polyamine N acetyltransferase 1) (Putrescine acetyltransferase) (Spermidine/spermine N(1) acetyltransferase 1) (SSAT) (SSAT 1)

Length: 171  Mass: 20024

Sequence MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFA
MYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSS
EEGWRLFKIDKEYLLKMATEE
Structural information
Protein Domains
(4..17-)
(/note="N-acetyltransferase-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00532"-)
Interpro:  IPR016181  IPR000182  IPR032957  
Prosite:   PS51186

PDB:  
2B3U 2B3V 2B4B 2B4D 2B58 2B5G 2F5I 2FXF 2G3T 2JEV
PDBsum:   2B3U 2B3V 2B4B 2B4D 2B58 2B5G 2F5I 2FXF 2G3T 2JEV

DIP:  

36801

MINT:  
STRING:   ENSP00000368572
Other Databases GeneCards:  SAT1  Malacards:  SAT1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0032918 spermidine acetylation
IBA biological process
GO:0004145 diamine N-acetyltransfera
se activity
IBA molecular function
GO:0005829 cytosol
IBA cellular component
GO:0008080 N-acetyltransferase activ
ity
IBA molecular function
GO:0019809 spermidine binding
IBA molecular function
GO:0004145 diamine N-acetyltransfera
se activity
IEA molecular function
GO:0008080 N-acetyltransferase activ
ity
IEA molecular function
GO:0016740 transferase activity
IEA molecular function
GO:0016746 transferase activity, tra
nsferring acyl groups
IEA molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0004145 diamine N-acetyltransfera
se activity
TAS molecular function
GO:0004145 diamine N-acetyltransfera
se activity
IEA molecular function
GO:0004145 diamine N-acetyltransfera
se activity
TAS molecular function
GO:0004145 diamine N-acetyltransfera
se activity
TAS molecular function
GO:0005829 cytosol
TAS cellular component
GO:0005829 cytosol
TAS cellular component
GO:0006596 polyamine biosynthetic pr
ocess
TAS biological process
GO:0005622 intracellular
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0042127 regulation of cell popula
tion proliferation
IEA biological process
GO:0019809 spermidine binding
IEA molecular function
GO:0008080 N-acetyltransferase activ
ity
IEA molecular function
GO:0006595 polyamine metabolic proce
ss
IEA biological process
GO:0005829 cytosol
IEA cellular component
GO:0032918 spermidine acetylation
IEA biological process
GO:0006598 polyamine catabolic proce
ss
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0009447 putrescine catabolic proc
ess
IEA biological process
GO:0001525 angiogenesis
IEP biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa01100Metabolic pathways
hsa00330Arginine and proline metabolism
hsa04216Ferroptosis
Associated diseases References
Keratosis follicularis spinulosa decalvans KEGG:H00750
Keratosis follicularis spinulosa decalvans KEGG:H00750
Hypospermatogenesis MIK: 28361989
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract