• Gene id: 6302

Gene Summary

• Gene Symbol: TSPAN31   Gene   UCSC   Ensembl
• Aliases: SAS
• Gene name: tetraspanin 31
• Alternate names: tetraspanin-31, sarcoma-amplified sequence, transmembrane 4 protein, tspan-31,
• Gene location: 12q14.1 (57745038: 57750218)     Exons: 7     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 150341

Protein Summary

• Protein general information: Q12999  
  • Name: Tetraspanin 31 (Tspan 31) (Sarcoma amplified sequence)
  • Length: 210  
  • Mass: 23053
• Sequence:

  MVCGGFACSKNALCALNVVYMLVSLLLIGVAAWGKGLGLVSSIHIIGGVIAVGVFLLLIAVAGLVGAVNHHQVLL
  FFYMIILGLVFIFQFVISCSCLAINRSKQTDVINASWWVMSNKTRDELERSFDCCGLFNLTTLYQQDYDFCTAIC
  KSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMRFRNQKDPRANPSAFL

• Structural information:
  • Interpro: IPR000301  IPR018499  
  • STRING: ENSP00000257910
• Other Databases: GeneCards:  TSPAN31  Malacards:  TSPAN31

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Osteosarcoma	KEGG:H00036
Osteosarcoma	KEGG:H00036
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881