• Gene id: 6301

Gene Summary

• Gene Symbol: SARS1   Gene   UCSC   Ensembl
• Aliases: NEDMAS, SARS, SERRS, SERS
• Gene name: seryl-tRNA synthetase 1
• Alternate names: serine--tRNA ligase, cytoplasmic, serine tRNA ligase 1, cytoplasmic, seryl-tRNA synthetase, cytoplasmic, seryl-tRNA(Ser/Sec) synthetase,
• Gene location: 1p13.3 (109213892: 109238181)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene belongs to the class II amino-acyl tRNA family. The encoded enzyme catalyzes the transfer of L-serine to tRNA (Ser) and is related to bacterial and yeast counterparts. Multiple alternatively spliced transcript variants have been described but th
• OMIM: 607529

Protein Summary

• Protein general information: P49591  
  • Name: Serine tRNA ligase, cytoplasmic (EC 6.1.1.11) (Seryl tRNA synthetase) (SerRS) (Seryl tRNA(Ser/Sec) synthetase)
  • Length: 514  
  • Mass: 58777
  • Tissue specificity: Brain. {ECO
• Sequence:

  MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVG
  DDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDED
  VDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYT
  PFFMRKEVMQEVAQLSQFDEELYKVIGKGSEKSDDNSYDEKYLIATSEQPIAALHRDEWLRPEDLPIKYAGLSTC
  FRQEVGSHGRDTRGIFRVHQFEKIEQFVYSSPHDNKSWEMFEEMITTAEEFYQSLGIPYHIVNIVSGSLNHAASK
  KLDLEAWFPGSGAFRELVSCSNCTDYQARRLRIRYGQTKKMMDKVEFVHMLNATMCATTRTICAILENYQTEKGI
  TVPEKLKEFMPPGLQELIPFVKPAPIEQEPSKKQKKQHEGSKKKAAARDVTLENRLQNMEVTDA

• Structural information:
  • Interpro: IPR002314  IPR006195  IPR002317  IPR015866  IPR042103   IPR033729  IPR010978  
  • Prosite: PS50862
  • CDD: cd00770
  • PDB: 3VBB 4L87 4RQE 4RQF
  • PDBsum: 3VBB 4L87 4RQE 4RQF
  • DIP: 38215
  • STRING: ENSP00000234677
• Other Databases: GeneCards:  SARS1  Malacards:  SARS1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004828	serine-tRNA ligase activity	IBA	molecular function
GO:0006434	seryl-tRNA aminoacylation	IBA	biological process
GO:0000049	tRNA binding	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0004828	serine-tRNA ligase activity	IDA	molecular function
GO:0006434	seryl-tRNA aminoacylation	IDA	biological process
GO:1904046	negative regulation of vascular endothelial growth factor production	IDA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0016525	negative regulation of angiogenesis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006434	seryl-tRNA aminoacylation	IMP	biological process
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006418	tRNA aminoacylation for protein translation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004828	serine-tRNA ligase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006434	seryl-tRNA aminoacylation	IEA	biological process
GO:0004812	aminoacyl-tRNA ligase activity	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016874	ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003723	RNA binding	TAS	molecular function
GO:0004828	serine-tRNA ligase activity	TAS	molecular function
GO:0006412	translation	TAS	biological process
GO:0008033	tRNA processing	TAS	biological process
GO:0004828	serine-tRNA ligase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006418	tRNA aminoacylation for protein translation	TAS	biological process
GO:0016259	selenocysteine metabolic process	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0097056	selenocysteinyl-tRNA(Sec) biosynthetic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00970	Aminoacyl-tRNA biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881