• Gene id: 6300

Gene Summary

• Gene Symbol: MAPK12   Gene   UCSC   Ensembl
• Aliases: ERK-6, ERK3, ERK6, MAPK 12, P38GAMMA, PRKM12, SAPK-3, SAPK3
• Gene name: mitogen-activated protein kinase 12
• Alternate names: mitogen-activated protein kinase 12, MAP kinase 12, MAP kinase p38 gamma, extracellular signal-regulated kinase 6, mitogen-activated protein kinase 3, mitogen-activated protein kinase p38 gamma, stress-activated protein kinase 3,
• Gene location: 22q13.33 (50261809: 50252900)     Exons: 12     NC_000022.11
• Gene summary(Entrez): Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t
• OMIM: 602282

Protein Summary

• Protein general information: P53778  
  • Name: Mitogen activated protein kinase 12 (MAP kinase 12) (MAPK 12) (EC 2.7.11.24) (Extracellular signal regulated kinase 6) (ERK 6) (Mitogen activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress activated protein kinase 3)
  • Length: 367  
  • Mass: 41940
  • Tissue specificity: Highly expressed in skeletal muscle and heart. {ECO
• Sequence:

  MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYREL
  RLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGII
  HRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTL
  FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
  TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

• Structural information:
  • Protein Domains: (27..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR003527  IPR008352  IPR038786  IPR000719   IPR017441  
  • Prosite: PS01351 PS00107 PS50011
  • CDD: cd07880
  • PDB: 1CM8 4QUM 6UNA
  • PDBsum: 1CM8 4QUM 6UNA
  • DIP: 34241
  • STRING: ENSP00000215659
• Other Databases: GeneCards:  MAPK12  Malacards:  MAPK12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010952	positive regulation of peptidase activity	NAS	biological process
GO:0018105	peptidyl-serine phosphorylation	TAS	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0000165	MAPK cascade	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0006975	DNA damage induced protein phosphorylation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0045786	negative regulation of cell cycle	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0045445	myoblast differentiation	IDA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010952	positive regulation of peptidase activity	NAS	biological process
GO:0018105	peptidyl-serine phosphorylation	TAS	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0000165	MAPK cascade	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004707	MAP kinase activity	TAS	molecular function
GO:0006975	DNA damage induced protein phosphorylation	TAS	biological process
GO:0007050	cell cycle arrest	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007517	muscle organ development	TAS	biological process
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051149	positive regulation of muscle cell differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0045786	negative regulation of cell cycle	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0045445	myoblast differentiation	IDA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04714	Thermogenesis
hsa05131	Shigellosis
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa05130	Pathogenic Escherichia coli infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05205	Proteoglycans in cancer
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa04261	Adrenergic signaling in cardiomyocytes
hsa05152	Tuberculosis
hsa04218	Cellular senescence
hsa05161	Hepatitis B
hsa04728	Dopaminergic synapse
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa04114	Oocyte meiosis
hsa05135	Yersinia infection
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04068	FoxO signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04935	Growth hormone synthesis, secretion and action
hsa04668	TNF signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04659	Th17 cell differentiation
hsa04620	Toll-like receptor signaling pathway
hsa05145	Toxoplasmosis
hsa04914	Progesterone-mediated oocyte maturation
hsa04912	GnRH signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05142	Chagas disease
hsa04658	Th1 and Th2 cell differentiation
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa01522	Endocrine resistance
hsa04657	IL-17 signaling pathway
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa04622	RIG-I-like receptor signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05133	Pertussis
hsa04917	Prolactin signaling pathway
hsa05140	Leishmaniasis
hsa05014	Amyotrophic lateral sclerosis
hsa04370	VEGF signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq