• Gene id: 6288

Gene Summary

• Gene Symbol: SAA1   Gene   UCSC   Ensembl
• Aliases: PIG4, SAA, SAA2, TP53I4
• Gene name: serum amyloid A1
• Alternate names: serum amyloid A-1 protein, serum amyloid A protein, tumor protein p53 inducible protein 4,
• Gene location: 11p15.1 (18266224: 18269976)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the serum amyloid A family of apolipoproteins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a major acute phase protein that is highly expressed in response to inflamm
• OMIM: 104750

Protein Summary

• Protein general information: P0DJI8  
  • Name: Serum amyloid A 1 protein (SAA) [Cleaved into: Amyloid protein A (Amyloid fibril protein AA); Serum amyloid protein A(2 104); Serum amyloid protein A(3 104); Serum amyloid protein A(2 103); Serum amyloid protein A(2 102); Serum amyloid protein A(4 101)]
  • Length: 122  
  • Mass: 13,532
• Sequence:

  MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEA
  ISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY

• Structural information:
  • Interpro: IPR000096  
  • Prosite: PS00992
  • PDB: 4IP8 4IP9
  • PDBsum: 4IP8 4IP9
  • STRING: ENSP00000348918
• Other Databases: GeneCards:  SAA1  Malacards:  SAA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0001664	G-protein coupled receptor binding	IDA	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0006953	acute-phase response	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0030168	platelet activation	NAS	biological process
GO:0030593	neutrophil chemotaxis	NAS	biological process
GO:0034364	high-density lipoprotein particle	IEA	cellular component
GO:0042056	chemoattractant activity	IBA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045785	positive regulation of cell adhesion	NAS	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0048246	macrophage chemotaxis	IDA	biological process
GO:0048247	lymphocyte chemotaxis	IDA	biological process
GO:0050708	regulation of protein secretion	NAS	biological process
GO:0050715	positive regulation of cytokine secretion	IDA	biological process
GO:0050716	positive regulation of interleukin-1 secretion	NAS	biological process
GO:0050728	negative regulation of inflammatory response	NAS	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071682	endocytic vesicle lumen	TAS	cellular component
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0001664	G-protein coupled receptor binding	IDA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0006953	acute-phase response	IEA	biological process
GO:0006953	acute-phase response	IEA	biological process
GO:0006953	acute-phase response	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0030168	platelet activation	NAS	biological process
GO:0030593	neutrophil chemotaxis	NAS	biological process
GO:0034364	high-density lipoprotein particle	IEA	cellular component
GO:0042056	chemoattractant activity	IBA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045785	positive regulation of cell adhesion	NAS	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0048246	macrophage chemotaxis	IDA	biological process
GO:0048247	lymphocyte chemotaxis	IDA	biological process
GO:0050708	regulation of protein secretion	NAS	biological process
GO:0050715	positive regulation of cytokine secretion	IDA	biological process
GO:0050716	positive regulation of interleukin-1 secretion	NAS	biological process
GO:0050728	negative regulation of inflammatory response	NAS	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071682	endocytic vesicle lumen	TAS	cellular component
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0001664	G-protein coupled receptor binding	IDA	molecular function
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0006898	receptor-mediated endocytosis	TAS	biological process
GO:0006953	acute-phase response	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	NAS	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IDA	biological process
GO:0030168	platelet activation	NAS	biological process
GO:0030593	neutrophil chemotaxis	NAS	biological process
GO:0042056	chemoattractant activity	IBA	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0045785	positive regulation of cell adhesion	NAS	biological process
GO:0045785	positive regulation of cell adhesion	IDA	biological process
GO:0048246	macrophage chemotaxis	IDA	biological process
GO:0048247	lymphocyte chemotaxis	IDA	biological process
GO:0050708	regulation of protein secretion	NAS	biological process
GO:0050715	positive regulation of cytokine secretion	IDA	biological process
GO:0050716	positive regulation of interleukin-1 secretion	NAS	biological process
GO:0050728	negative regulation of inflammatory response	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071682	endocytic vesicle lumen	TAS	cellular component

Diseases

Associated diseases	References
Cardiovascular disease	GAD: 19729864
Hypertension	GAD: 11592044
Rheumatoid arthritis	GAD: 11407685
Amyloidosis	GAD: 14696796
Alzheimer's disease	GAD: 19141999
Premature ovarian insufficiency (POI)	INFBASE: 25647778
Pelvic endometriosis	INFBASE: 24050030
Endometriosis	INFBASE: 19230253
Male subfertility	MIK: 9111881
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male subfertility	MIK: 9111881

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
9111881	Male subfertility				Male infertility	SAA-1
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881