• Gene id: 6284

Gene Summary

• Gene Symbol: S100A13   Gene   UCSC   Ensembl
• Gene name: S100 calcium binding protein A13
• Alternate names: protein S100-A13,
• Gene location: 1q21.3 (153634360: 153618798)     Exons: 10     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 603068

Protein Summary

• Protein general information: Q99584  
  • Name: Protein S100 A13 (S100 calcium binding protein A13)
  • Length: 98  
  • Mass: 11471
  • Tissue specificity: Expressed in heart and skeletal muscle.
• Sequence:

  MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNE
  YWRLIGELAKEIRKKKDLKIRKK

• Structural information:
  • Protein Domains: (18..5-)
    (/note="EF-hand"-)
  • Interpro: IPR011992  IPR013787  IPR028487  
  • PDB: 1YUR 1YUS 1YUT 1YUU 2EGD 2H2K 2K8M 2KI4 2KI6 2KOT 2L5X 2LE9
  • PDBsum: 1YUR 1YUS 1YUT 1YUU 2EGD 2H2K 2K8M 2KI4 2KI6 2KOT 2L5X 2LE9
  • STRING: ENSP00000357688
• Other Databases: GeneCards:  S100A13  Malacards:  S100A13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050703	interleukin-1 alpha secretion	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0005507	copper ion binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0050663	cytokine secretion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005507	copper ion binding	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008360	regulation of cell shape	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0051602	response to electrical stimulus	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0008270	zinc ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0050786	RAGE receptor binding	IPI	molecular function
GO:0043303	mast cell degranulation	NAS	biological process
GO:0017134	fibroblast growth factor binding	IPI	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray