• Gene id: 6283

Gene Summary

• Gene Symbol: S100A12   Gene   UCSC   Ensembl
• Aliases: CAAF1, CAGC, CGRP, ENRAGE, MRP-6, MRP6, p6
• Gene name: S100 calcium binding protein A12
• Alternate names: protein S100-A12, EN-RAGE, calcitermin, calcium-binding protein in amniotic fluid 1, calgranulin C, extracellular newly identified RAGE-binding protein, migration inhibitory factor-related protein 6, neutrophil S100 protein,
• Gene location: 1q21.3 (153375598: 153373707)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 603112

Protein Summary

• Protein general information: P80511  
  • Name: Protein S100 A12 (CGRP) (Calcium binding protein in amniotic fluid 1) (CAAF1) (Calgranulin C) (CAGC) (Extracellular newly identified RAGE binding protein) (EN RAGE) (Migration inhibitory factor related protein 6) (MRP 6) (p6) (Neutrophil S100 protein) (S1
  • Length: 92  
  • Mass: 10,575
• Sequence:

  MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFI
  SLVAIALKAAHYHTHKE

• Structural information:
  • Protein Domains: EF-hand (13-48)
    EF-hand (49-84)
  • Interpro: IPR011992  IPR002048  IPR001751  IPR013787  
  • Prosite: PS50222 PS00303
  • PDB: 1E8A 1GQM 1ODB 2M9G 2WC8 2WCB 2WCE 2WCF
  • PDBsum: 1E8A 1GQM 1ODB 2M9G 2WC8 2WCB 2WCE 2WCF
  • STRING: ENSP00000357726
• Other Databases: GeneCards:  S100A12  Malacards:  S100A12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002548	monocyte chemotaxis	TAS	biological process
GO:0005507	copper ion binding	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0030593	neutrophil chemotaxis	TAS	biological process
GO:0031640	killing of cells of other organism	IEA	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045576	mast cell activation	TAS	biological process
GO:0050663	cytokine secretion	TAS	biological process
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0050786	RAGE receptor binding	IPI	molecular function
GO:0050786	RAGE receptor binding	TAS	molecular function
GO:0050786	RAGE receptor binding	IDA	molecular function
GO:0050832	defense response to fungus	IDA	biological process
GO:0050832	defense response to fungus	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002548	monocyte chemotaxis	TAS	biological process
GO:0005507	copper ion binding	TAS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030593	neutrophil chemotaxis	TAS	biological process
GO:0031640	killing of cells of other organism	IEA	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	TAS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045576	mast cell activation	TAS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050663	cytokine secretion	TAS	biological process
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0050786	RAGE receptor binding	IPI	molecular function
GO:0050786	RAGE receptor binding	TAS	molecular function
GO:0050786	RAGE receptor binding	IDA	molecular function
GO:0050832	defense response to fungus	IEA	biological process
GO:0050832	defense response to fungus	IDA	biological process
GO:0050832	defense response to fungus	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0002548	monocyte chemotaxis	TAS	biological process
GO:0005507	copper ion binding	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0030593	neutrophil chemotaxis	TAS	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045087	innate immune response	TAS	biological process
GO:0045576	mast cell activation	TAS	biological process
GO:0050663	cytokine secretion	TAS	biological process
GO:0050729	positive regulation of inflammatory response	TAS	biological process
GO:0050786	RAGE receptor binding	IPI	molecular function
GO:0050786	RAGE receptor binding	TAS	molecular function
GO:0050786	RAGE receptor binding	IDA	molecular function
GO:0050832	defense response to fungus	IDA	biological process
GO:0050832	defense response to fungus	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process

Diseases

Associated diseases	References
Endometriosis	INFBASE: 20537326
Varicocele	MIK: 26725070
Male infertility	MIK: 26725070
Varicocele	MIK: 26725070

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26725070	Male infertility, varicocele			136 (68 infertile men with varicocele, 68 healthy fertile controls)	Male infertility