• Gene id: 6282

Gene Summary

• Gene Symbol: S100A11   Gene   UCSC   Ensembl
• Aliases: HEL-S-43, MLN70, S100C
• Gene name: S100 calcium binding protein A11
• Alternate names: protein S100-A11, MLN 70, calgizzarin, epididymis secretory protein Li 43, metastatic lymph node gene 70 protein, protein S100-C,
• Gene location: 1q21.3 (152037034: 152032505)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 603114

Protein Summary

• Protein general information: P31949  
  • Name: Protein S100 A11 (Calgizzarin) (Metastatic lymph node gene 70 protein) (MLN 70) (Protein S100 C) (S100 calcium binding protein A11) [Cleaved into: Protein S100 A11, N terminally processed]
  • Length: 105  
  • Mass: 11,740
• Sequence:

  MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQL
  DFSEFLNLIGGLAMACHDSFLKAVPSQKRT

• Structural information:
  • Protein Domains: EF-hand (13-49)
    EF-hand (55-90)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR001751  IPR013787   IPR028482  
  • Prosite: PS00018 PS50222 PS00303
  • PDB: 1V4Z 1V50 2LUC
  • PDBsum: 1V4Z 1V50 2LUC
  • STRING: ENSP00000271638
• Other Databases: GeneCards:  S100A11  Malacards:  S100A11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001726	ruffle	IDA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008156	negative regulation of DNA replication	TAS	biological process
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0048306	calcium-dependent protein binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008156	negative regulation of DNA replication	TAS	biological process
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0042127	regulation of cell proliferation	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0048306	calcium-dependent protein binding	IEA	molecular function
GO:0048306	calcium-dependent protein binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0001726	ruffle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008156	negative regulation of DNA replication	TAS	biological process
GO:0008285	negative regulation of cell proliferation	TAS	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0044548	S100 protein binding	IPI	molecular function
GO:0048306	calcium-dependent protein binding	IDA	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

Diseases

Associated diseases	References
Endometrial receptivity	INFBASE: 22869607
Embryo implantation	INFBASE: 22869607
Asthenozoospermia	MIK: 20231113
Asthenozoospermia	MIK: 20369545
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 20231113
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20369545	Asthenozoospermia			6 seminal plasma samples were collected by Percoll respectively from healthy fertile and asthenozoospermia volunteers	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
20231113	Asthenozoospermia			12 (6 healthy fertile men, 6 asthenozoospermia volunteers)	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R