• Gene id: 6281

Gene Summary

• Gene Symbol: S100A10   Gene   UCSC   Ensembl
• Aliases: 42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, P11, p10
• Gene name: S100 calcium binding protein A10
• Alternate names: protein S100-A10, S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)), annexin II ligand, calpactin I, light polypeptide, annexin II tetramer (AIIt) p11 subunit, calpactin I light chain, calpactin-1 light chain, cellular l,
• Gene location: 1q21.3 (151993858: 151982914)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 603775

Protein Summary

• Protein general information: P60903  
  • Name: Protein S100 A10 (Calpactin I light chain) (Calpactin 1 light chain) (Cellular ligand of annexin II) (S100 calcium binding protein A10) (p10 protein) (p11)
  • Length: 97  
  • Mass: 11203
• Sequence:

  MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSL
  IAGLTIACNDYFVVHMKQKGKK

• Structural information:
  • Interpro: IPR011992  IPR028476  IPR001751  IPR013787  
  • Prosite: PS00303
  • CDD: cd05024
  • PDB: 1A4P 1BT6 4DRW 4FTG 4HRE 4HRG 4HRH
  • PDBsum: 1A4P 1BT6 4DRW 4FTG 4HRE 4HRG 4HRH
  • STRING: ENSP00000357801
• Other Databases: GeneCards:  S100A10  Malacards:  S100A10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042493	response to drug	IEA	biological process
GO:0051099	positive regulation of binding	IEA	biological process
GO:0019897	extrinsic component of plasma membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0045121	membrane raft	IDA	colocalizes with
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0008289	lipid binding	IDA	NOT|molecular function
GO:0006900	vesicle budding from membrane	IDA	biological process
GO:0001765	membrane raft assembly	IDA	biological process
GO:1990665	AnxA2-p11 complex	IDA	cellular component
GO:1990665	AnxA2-p11 complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0044325	ion channel binding	IPI	molecular function
GO:0051894	positive regulation of focal adhesion assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881