• Gene id: 6280

Gene Summary

• Gene Symbol: S100A9   Gene   UCSC   Ensembl
• Aliases: 60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14
• Gene name: S100 calcium binding protein A9
• Alternate names: protein S100-A9, MRP-14, calgranulin B, calprotectin L1H subunit, leukocyte L1 complex heavy chain, migration inhibitory factor-related protein 14,
• Gene location: 1q21.3 (153357853: 153361026)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 123886

Protein Summary

• Protein general information: P06702  
  • Name: Protein S100 A9 (Calgranulin B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor related protein 14) (MRP 14) (p14) (S100 calcium binding protein A9)
  • Length: 114  
  • Mass: 13,242
• Sequence:

  MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLS
  FEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

• Structural information:
  • Protein Domains: EF-hand (12-47)
    EF-hand (54-89)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR028475  IPR001751   IPR013787  
  • Prosite: PS00018 PS50222 PS00303
  • PDB: 1IRJ 1XK4 4GGF 4XJK 5I8N 5W1F
  • PDBsum: 1IRJ 1XK4 4GGF 4XJK 5I8N 5W1F
  • DIP: 1166
  • STRING: ENSP00000357727
• Other Databases: GeneCards:  S100A9  Malacards:  S100A9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001816	cytokine production	TAS	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IDA	biological process
GO:0002793	positive regulation of peptide secretion	IEA	biological process
GO:0004871	signal transducer activity	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0006914	autophagy	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008017	microtubule binding	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0014002	astrocyte development	IEA	biological process
GO:0016209	antioxidant activity	IEA	molecular function
GO:0030194	positive regulation of blood coagulation	IEA	biological process
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0032119	sequestering of zinc ion	TAS	biological process
GO:0032602	chemokine production	TAS	biological process
GO:0035606	peptidyl-cysteine S-trans-nitrosylation	IDA	biological process
GO:0035662	Toll-like receptor 4 binding	TAS	molecular function
GO:0042742	defense response to bacterium	TAS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045113	regulation of integrin biosynthetic process	IEA	biological process
GO:0050544	arachidonic acid binding	TAS	molecular function
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0050786	RAGE receptor binding	TAS	molecular function
GO:0050832	defense response to fungus	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070488	neutrophil aggregation	IDA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IDA	biological process
GO:0001816	cytokine production	TAS	biological process
GO:0002376	immune system process	IEA	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IDA	biological process
GO:0002793	positive regulation of peptide secretion	IEA	biological process
GO:0004871	signal transducer activity	TAS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0006914	autophagy	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008017	microtubule binding	TAS	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0014002	astrocyte development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016209	antioxidant activity	IEA	molecular function
GO:0018119	peptidyl-cysteine S-nitrosylation	IEA	biological process
GO:0030194	positive regulation of blood coagulation	IEA	biological process
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0032119	sequestering of zinc ion	TAS	biological process
GO:0032602	chemokine production	TAS	biological process
GO:0035606	peptidyl-cysteine S-trans-nitrosylation	IDA	biological process
GO:0035662	Toll-like receptor 4 binding	IEA	molecular function
GO:0035662	Toll-like receptor 4 binding	TAS	molecular function
GO:0042742	defense response to bacterium	TAS	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0045113	regulation of integrin biosynthetic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050544	arachidonic acid binding	IEA	molecular function
GO:0050544	arachidonic acid binding	TAS	molecular function
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0050786	RAGE receptor binding	IEA	molecular function
GO:0050786	RAGE receptor binding	TAS	molecular function
GO:0050832	defense response to fungus	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070488	neutrophil aggregation	IDA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IDA	biological process
GO:0001816	cytokine production	TAS	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IDA	biological process
GO:0004871	signal transducer activity	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006914	autophagy	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0008017	microtubule binding	TAS	molecular function
GO:0008270	zinc ion binding	TAS	molecular function
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0032119	sequestering of zinc ion	TAS	biological process
GO:0032602	chemokine production	TAS	biological process
GO:0035606	peptidyl-cysteine S-trans-nitrosylation	IDA	biological process
GO:0035662	Toll-like receptor 4 binding	TAS	molecular function
GO:0042742	defense response to bacterium	TAS	biological process
GO:0050544	arachidonic acid binding	TAS	molecular function
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0050786	RAGE receptor binding	TAS	molecular function
GO:0050832	defense response to fungus	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070488	neutrophil aggregation	IDA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 20231113
Dermatitis	GAD: 19601998
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 20231113
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20231113	Asthenozoospermia			12 (6 healthy fertile men, 6 asthenozoospermia volunteers)	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881