• Gene id: 6279

Gene Summary

• Gene Symbol: S100A8   Gene   UCSC   Ensembl
• Aliases: 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8
• Gene name: S100 calcium binding protein A8
• Alternate names: protein S100-A8, calgranulin A, calprotectin L1L subunit, cystic fibrosis antigen, leukocyte L1 complex light chain, migration inhibitory factor-related protein 8, urinary stone protein band A,
• Gene location: 1q21.3 (153422582: 153390031)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Protein Summary

• Protein general information: P05109  
  • Name: Protein S100 A8 (Calgranulin A) (Calprotectin L1L subunit) (Cystic fibrosis antigen) (CFAG) (Leukocyte L1 complex light chain) (Migration inhibitory factor related protein 8) (MRP 8) (p8) (S100 calcium binding protein A8) (Urinary stone protein band A)
  • Length: 93  
  • Mass: 10835
  • Tissue specificity: Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutr
• Sequence:

  MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILV
  IKMGVAAHKKSHEESHKE

• Structural information:
  • Protein Domains: (12..4-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (46..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR001751  IPR013787   IPR028474  
  • Prosite: PS00018 PS50222 PS00303
  • PDB: 1MR8 1XK4 4GGF 4XJK 5HLO 5HLV 5W1F 6DS2
  • PDBsum: 1MR8 1XK4 4GGF 4XJK 5HLO 5HLV 5W1F 6DS2
  • DIP: 1165
  • STRING: ENSP00000357722
• Other Databases: GeneCards:  S100A8  Malacards:  S100A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050729	positive regulation of inflammatory response	IDA	biological process
GO:0030593	neutrophil chemotaxis	IDA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0002523	leukocyte migration involved in inflammatory response	IDA	biological process
GO:0070488	neutrophil aggregation	IDA	biological process
GO:0006914	autophagy	IDA	biological process
GO:0051493	regulation of cytoskeleton organization	TAS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	TAS	biological process
GO:0050832	defense response to fungus	TAS	biological process
GO:0050786	RAGE receptor binding	TAS	molecular function
GO:0050544	arachidonic acid binding	TAS	molecular function
GO:0032119	sequestering of zinc ion	TAS	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0008017	microtubule binding	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005509	calcium ion binding	TAS	molecular function
GO:0018119	peptidyl-cysteine S-nitrosylation	IMP	biological process
GO:0042742	defense response to bacterium	TAS	biological process
GO:0035662	Toll-like receptor 4 binding	TAS	molecular function
GO:0032602	chemokine production	TAS	biological process
GO:0030307	positive regulation of cell growth	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0001816	cytokine production	TAS	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0050544	arachidonic acid binding	IEA	molecular function
GO:0050727	regulation of inflammatory response	IEA	biological process
GO:0050786	RAGE receptor binding	IEA	molecular function
GO:0035662	Toll-like receptor 4 binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005509	calcium ion binding	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045471	response to ethanol	IEA	biological process
GO:0042060	wound healing	IEA	biological process
GO:0035425	autocrine signaling	IEA	biological process
GO:0010043	response to zinc ion	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0002544	chronic inflammatory response	IEA	biological process
GO:0014002	astrocyte development	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0002526	acute inflammatory response	IEA	biological process
GO:0002793	positive regulation of peptide secretion	IEA	biological process
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
urinary bladder cancer	PMID:17970044
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R