• Gene id: 6278

Gene Summary

• Gene Symbol: S100A7   Gene   UCSC   Ensembl
• Aliases: PSOR1, S100A7c
• Gene name: S100 calcium binding protein A7
• Alternate names: protein S100-A7, psoriasin 1,
• Gene location: 1q21.3 (153460650: 153457743)     Exons: 3     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
• OMIM: 602729

Protein Summary

• Protein general information: P31151  
  • Name: Protein S100 A7 (Psoriasin) (S100 calcium binding protein A7)
  • Length: 101  
  • Mass: 11471
  • Tissue specificity: Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients. {ECO
• Sequence:

  MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEF
  LSLLGDIATDYHKQSHGAAPCSGGSQ

• Structural information:
  • Protein Domains: (13..4-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (50..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR034325  IPR001751   IPR013787  IPR028477  
  • Prosite: PS00018 PS50222 PS00303
  • CDD: cd00213
  • PDB: 1PSR 2PSR 2WND 2WOR 2WOS 3PSR 4AQJ
  • PDBsum: 1PSR 2PSR 2WND 2WOR 2WOS 3PSR 4AQJ
  • STRING: ENSP00000357712
• Other Databases: GeneCards:  S100A7  Malacards:  S100A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0046914	transition metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008544	epidermis development	TAS	biological process
GO:0019730	antimicrobial humoral response	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0010820	positive regulation of T cell chemotaxis	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0051238	sequestering of metal ion	IDA	biological process
GO:0008270	zinc ion binding	IC	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0000302	response to reactive oxygen species	IDA	biological process
GO:0090026	positive regulation of monocyte chemotaxis	IDA	biological process
GO:0071624	positive regulation of granulocyte chemotaxis	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0001525	angiogenesis	NAS	biological process
GO:0032496	response to lipopolysaccharide	IEP	biological process
GO:0030216	keratinocyte differentiation	NAS	biological process
GO:0005925	focal adhesion	NAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	biological process
GO:0050786	RAGE receptor binding	IPI	molecular function
GO:0045087	innate immune response	NAS	biological process
GO:0008270	zinc ion binding	NAS	molecular function
GO:0050829	defense response to Gram-negative bacterium	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)